Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- TRIF antibody, Western blottingAll lanes: Anti TRIF at 0.5ug/ml)

anti-Mouse TRIF Polyclonal Antibody | anti-TRIF antibody

Anti-TRIF Antibody

Gene Names
Ticam1; TRIF; TICAM-1; AW046014; AW547018
Reactivity
Mouse
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
TRIF; Polyclonal Antibody; Anti-TRIF Antibody; TIR domain-containing adapter molecule 1; MGC35334; Proline rich vinculin and TIR domain containing protein B; Proline-rich; PRVTIRB; Putative NF kappa B activating protein 502H; Putative NF-kappa-B-activating protein 502H; Putative NFkB activating protein; TCAM1_HUMAN; TICAM 1; TICAM-1; TICAM1; TIR domain containing adapter molecule 1; TIR domain containing adapter protein inducing IFN beta; TIR domain containing adaptor inducing interferon beta; TIR domain-containing adapter protein inducing IFN-beta; Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta; Toll like receptor adaptor molecule 1; Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta; TRIF protein; vinculin and TIR domain-containing protein B antibody; toll-like receptor adaptor molecule 1; anti-TRIF antibody
Ordering
For Research Use Only!
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
732
Applicable Applications for anti-TRIF antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse TRIF (53-84aa QDTEARVSLESLKMNTVAQLVAHQWADMETTE), different from the related human sequence by twelve amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- TRIF antibody, Western blottingAll lanes: Anti TRIF at 0.5ug/ml)

Western Blot (WB) (Anti- TRIF antibody, Western blottingAll lanes: Anti TRIF at 0.5ug/ml)
Related Product Information for anti-TRIF antibody
Description: Rabbit IgG polyclonal antibody for TIR domain-containing adapter molecule 1(TICAM1) detection. Tested with WB in Mouse.

Background: TICAM1 (TIR DOMAIN-CONTAINING ADAPTOR MOLECULE 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.
References
1. Carty, M., Goodbody, R., Schroder, M., Stack, J., Moynagh, P. N., Bowie, A. G.The human adaptor SARM negatively regulates adaptor protein TRIF-dependent Toll-like receptor signaling.Nature Immun. 7: 1074-1081, 2006. 2. Oshiumi, H., Matsumoto, M., Funami, K., Akazawa, T., Seya, T.TICAM-I, an adaptor molecule that participates in Toll-like receptor 3-mediated interferon-beta induction.Nature Immun. 4: 161-167, 2003. 3. Yamamoto, M., Sato, S., Mori, K., Hoshino, K., Takeuchi, O., Takeda, K., Akira, S.Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.J. Immun. 169: 6668-6672, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,230 Da
NCBI Official Full Name
TIR domain-containing adapter molecule 1
NCBI Official Synonym Full Names
toll-like receptor adaptor molecule 1
NCBI Official Symbol
Ticam1
NCBI Official Synonym Symbols
TRIF; TICAM-1; AW046014; AW547018
NCBI Protein Information
TIR domain-containing adapter molecule 1
UniProt Protein Name
TIR domain-containing adapter molecule 1
Protein Family
UniProt Gene Name
Ticam1
UniProt Synonym Gene Names
Trif; TICAM-1; TIR domain-containing adapter protein inducing IFN-beta
UniProt Entry Name
TCAM1_MOUSE

Uniprot Description

TICAM1: an adaptor protein involved in innate immunity against invading pathogens. Associates with TLR3 and TLR4 (through TICAM2) to mediate NF-kappa-B and interferon-regulatory factor (IRF) activation, and to induce apoptosis. Ligand binding to these receptors results in TICAM1 recruitment through its TIR domain. Distinct protein-interaction motifs allow recruitment of the effector proteins TBK1, TRAF6 and RIPK1, which in turn, lead to the activation of transcription factors IRF3 and IRF7, NF-kappa-B and FADD respectively. Interacts with the TIR domain of TLR3. Interacts with AZI2, TBK1, IRF3 and IRF7. Interacts with TICAM2 in TLR4 recruitment. Interaction with PIAS4 inhibits the TICAM1-induced NF-kappa-B, IRF and IFNB1 activation. Interacts with IKBKB and IKBKE. Interaction with SARM1 blocks TICAM1-dependent transcription factor activation. Interacts with TRAF3. Interacts with TRAFD1.

Protein type: Adaptor/scaffold; Apoptosis

Cellular Component: cytoplasmic vesicle

Molecular Function: protein binding; protein kinase binding; signal transducer activity

Biological Process: activation of NF-kappaB transcription factor; apoptosis; defense response to virus; immune system process; inflammatory response; innate immune response; lipopolysaccharide-mediated signaling pathway; macrophage activation during immune response; MyD88-independent toll-like receptor signaling pathway; positive regulation of B cell activation; positive regulation of B cell proliferation; positive regulation of chemokine biosynthetic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interferon type I production; positive regulation of interferon-beta biosynthetic process; positive regulation of interleukin-6 production; positive regulation of natural killer cell activation; positive regulation of nitric oxide biosynthetic process; positive regulation of protein binding; positive regulation of protein ubiquitination; positive regulation of tumor necrosis factor production; regulation of protein homodimerization activity; response to exogenous dsRNA; response to lipopolysaccharide; signal transduction

Research Articles on TRIF

Similar Products

Product Notes

The TRIF ticam1 (Catalog #AAA178058) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-TRIF Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TRIF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the TRIF ticam1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.