Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TREML2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Rabbit TREML2 Polyclonal Antibody | anti-TREML2 antibody

TREML2 antibody - N-terminal region

Gene Names
TREML2; TLT2; TLT-2; C6orf76; dJ238O23.1
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TREML2; Polyclonal Antibody; TREML2 antibody - N-terminal region; anti-TREML2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDNILKSGTVTTG
Sequence Length
380
Applicable Applications for anti-TREML2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 77%; Horse: 92%; Human: 100%; Pig: 85%; Rabbit: 86%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TREML2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TREML2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-TREML2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-TREML2 antibody
This is a rabbit polyclonal antibody against TREML2. It was validated on Western Blot

Target Description: TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
trem-like transcript 2 protein
NCBI Official Synonym Full Names
triggering receptor expressed on myeloid cells like 2
NCBI Official Symbol
TREML2
NCBI Official Synonym Symbols
TLT2; TLT-2; C6orf76; dJ238O23.1
NCBI Protein Information
trem-like transcript 2 protein
UniProt Protein Name
Trem-like transcript 2 protein
UniProt Gene Name
TREML2
UniProt Synonym Gene Names
C6orf76; TLT2
UniProt Entry Name
TRML2_HUMAN

NCBI Description

TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 (MIM 605085) and TREM2 (MIM 605086), but it has distinct structural and functional properties (Allcock et al., 2003 [PubMed 12645956]).[supplied by OMIM, Mar 2008]

Uniprot Description

TREML2: Cell surface receptor that may play a role in the innate and adaptive immune response. Acts as a counter-receptor for CD276 and interaction with CD276 on T-cells enhances T-cell activation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: cell surface; integral to membrane; plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: T cell activation

Research Articles on TREML2

Similar Products

Product Notes

The TREML2 treml2 (Catalog #AAA3209681) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TREML2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TREML2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TREML2 treml2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GRYWCMRNTS GILYPLMGFQ LDVSPAPQTE RNIPFTHLDN ILKSGTVTTG. It is sometimes possible for the material contained within the vial of "TREML2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.