Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RPS6KB1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human RPS6KB1 Polyclonal Antibody | anti-RPS6KB1 antibody

RPS6KB1 Antibody - N-terminal region

Gene Names
RPS6KB2; KLS; SRK; S6K2; S6KB; STK14B; S6KI(2); S6Kbeta; p70S6Kb; P70-beta; S6K-beta2; P70-beta-1; P70-beta-2; p70(S6K)-beta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
RPS6KB1; Polyclonal Antibody; RPS6KB1 Antibody - N-terminal region; anti-RPS6KB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILEC
Sequence Length
482
Applicable Applications for anti-RPS6KB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RPS6KB1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RPS6KB1Sample Tissue: Human Du145 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-RPS6KB1 antibody
This gene encodes a member of the ribosomal S6 kinase family of serine/threonine kinases. The encoded protein responds to mTOR (mammalian target of rapamycin) signaling to promote protein synthesis, cell growth, and cell proliferation. Activity of this gene has been associated with human cancer. Alternatively spliced transcript variants have been observed. The use of alternative translation start sites results in isoforms with longer or shorter N-termini which may differ in their subcellular localizations. There are two pseudogenes for this gene on chromosome 17.
Product Categories/Family for anti-RPS6KB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
ribosomal protein S6 kinase beta-2
NCBI Official Synonym Full Names
ribosomal protein S6 kinase B2
NCBI Official Symbol
RPS6KB2
NCBI Official Synonym Symbols
KLS; SRK; S6K2; S6KB; STK14B; S6KI(2); S6Kbeta; p70S6Kb; P70-beta; S6K-beta2; P70-beta-1; P70-beta-2; p70(S6K)-beta
NCBI Protein Information
ribosomal protein S6 kinase beta-2
UniProt Protein Name
Ribosomal protein S6 kinase beta-2
UniProt Gene Name
RPS6KB2
UniProt Synonym Gene Names
STK14B; S6K-beta-2; S6K2; P70S6K2; p70-S6K 2; SRK; S6K-beta; p70 S6 kinase beta; p70 S6K-beta; p70 S6KB; p70-beta
UniProt Entry Name
KS6B2_HUMAN

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq, Jan 2015]

Uniprot Description

P70S6KB: an AGC kinase of the RSK family that is required for cell growth and G1 cell cycle progression. Is phosphorylated and activated by mTOR in mitogenic pathways downstream of phosphoinositide 3 kinase (PI3K). Phosphorylates the S6 protein of the 40S ribosomal subunit and is involved in translational control of 5' oligopyrimidine tract mRNAs. Activity is controlled by multiple phosphorylation events located within the catalytic, linker and pseudosubstrate domains. Mouse knockout shows symptoms of insulin resistance, and increased insulin senstivity, resulting in protection against diet-induced obesity. Protein expression and activation upregulated in colon adenocarcinoma cell lines. Increased expression in breast cancer correlated with poor survival. Selectively amplified and overexpressed within the 17q23 breast cancer amplicon. Two isoforms produced by alternative initiation have been reported.

Protein type: Protein kinase, AGC; EC 2.7.11.1; Translation; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; AGC group; RSK family; p70 subfamily

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein serine/threonine kinase activity; ribosomal protein S6 kinase activity; peptide binding; ATP binding; protein kinase activity

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of translational initiation; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; translation; nerve growth factor receptor signaling pathway; protein kinase B signaling cascade; innate immune response; signal transduction; protein amino acid phosphorylation

Research Articles on RPS6KB1

Similar Products

Product Notes

The RPS6KB1 rps6kb2 (Catalog #AAA3224130) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RPS6KB1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS6KB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RPS6KB1 rps6kb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRKAKIVRNA KDTAHTRAER NILESVKHPF IVELAYAFQT GGKLYLILEC. It is sometimes possible for the material contained within the vial of "RPS6KB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.