Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Pancreas )

Rabbit anti-Human TPTE Polyclonal Antibody | anti-TPTE antibody

TPTE antibody - C-terminal region

Gene Names
TPTE; CT44; PTEN2
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
TPTE; Polyclonal Antibody; TPTE antibody - C-terminal region; anti-TPTE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL
Sequence Length
413
Applicable Applications for anti-TPTE antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human TPTE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Pancreas )

Immunohistochemistry (IHC) (Human Pancreas )

Western Blot (WB)

(WB Suggested Anti-TPTE Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-TPTE Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TPTE antibody
This is a rabbit polyclonal antibody against TPTE. It was validated on Western Blot and immunohistochemistry

Target Description: TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
putative tyrosine-protein phosphatase TPTE isoform alpha
NCBI Official Synonym Full Names
transmembrane phosphatase with tensin homology
NCBI Official Symbol
TPTE
NCBI Official Synonym Symbols
CT44; PTEN2
NCBI Protein Information
putative tyrosine-protein phosphatase TPTE

NCBI Description

This gene encodes a PTEN-related tyrosine phosphatase which may play a role in the signal transduction pathways of the endocrine or spermatogenic function of the testis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Research Articles on TPTE

Similar Products

Product Notes

The TPTE (Catalog #AAA3203291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPTE antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TPTE can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the TPTE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KILIDVFDGP PLYDDVKVQF FYSNLPTYYD NCSFYFWLHT SFIENNRLYL. It is sometimes possible for the material contained within the vial of "TPTE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.