Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit anti-Dog, Human C6orf21 Polyclonal Antibody | anti-LY6G6F antibody

C6orf21 antibody - N-terminal region

Gene Names
LY6G6F; G6f; NG32; LY6G6; LY6G6D; C6orf21
Reactivity
Dog, Human
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
C6orf21; Polyclonal Antibody; C6orf21 antibody - N-terminal region; anti-LY6G6F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEED
Sequence Length
297
Applicable Applications for anti-LY6G6F antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 85%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C6orf21
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-C6orf21 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-C6orf21 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-LY6G6F antibody
This is a rabbit polyclonal antibody against C6orf21. It was validated on Western Blot and immunohistochemistry

Target Description: The function remains unknown.
Product Categories/Family for anti-LY6G6F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
lymphocyte antigen 6 complex locus protein G6f
NCBI Official Synonym Full Names
lymphocyte antigen 6 family member G6F
NCBI Official Symbol
LY6G6F
NCBI Official Synonym Symbols
G6f; NG32; LY6G6; LY6G6D; C6orf21
NCBI Protein Information
lymphocyte antigen 6 complex locus protein G6f

NCBI Description

The human G6f protein is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition (de Vet et al., 2003 [PubMed 12852788]).[supplied by OMIM, Mar 2008]

Research Articles on LY6G6F

Similar Products

Product Notes

The LY6G6F (Catalog #AAA3207379) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C6orf21 antibody - N-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's C6orf21 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the LY6G6F for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CSPAAGSFTT LVAQVQVGRP APDPGKPGRE SRLRLLGNYS LWLEGSKEED. It is sometimes possible for the material contained within the vial of "C6orf21, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.