Western Blot (WB)
(WB Suggested Anti-TPST2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Rabbit TPST2 Polyclonal Antibody | anti-TPST2 antibody
TPST2 antibody - middle region
Gene Names
TPST2; TPST-2; TANGO13B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TPST2; Polyclonal Antibody; TPST2 antibody - middle region; anti-TPST2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL
Sequence Length
377
Applicable Applications for anti-TPST2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TPST2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TPST2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-TPST2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TPST2 antibody
This is a rabbit polyclonal antibody against TPST2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene.
Target Description: TPST2 catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. TPST2 is a type II integral membrane protein found in the Golgi body.The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-TPST2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
protein-tyrosine sulfotransferase 2 isoform 1
NCBI Official Synonym Full Names
tyrosylprotein sulfotransferase 2
NCBI Official Symbol
TPST2
NCBI Official Synonym Symbols
TPST-2; TANGO13B
NCBI Protein Information
protein-tyrosine sulfotransferase 2
UniProt Protein Name
Protein-tyrosine sulfotransferase 2
Protein Family
UniProt Gene Name
TPST2
UniProt Synonym Gene Names
TPST-2
UniProt Entry Name
TPST2_HUMAN
NCBI Description
The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]
Uniprot Description
TPST2: Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides. Belongs to the protein sulfotransferase family.
Protein type: Transferase; Membrane protein, integral; EC 2.8.2.20; Endoplasmic reticulum
Chromosomal Location of Human Ortholog: 22q12.1
Cellular Component: Golgi membrane; membrane; endoplasmic reticulum; integral to membrane
Molecular Function: protein-tyrosine sulfotransferase activity
Biological Process: fusion of sperm to egg plasma membrane; peptidyl-tyrosine sulfation
Research Articles on TPST2
Similar Products
Product Notes
The TPST2 tpst2 (Catalog #AAA3207436) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TPST2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TPST2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TPST2 tpst2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAIEVMYAQC MEVGKEKCLP VYYEQLVLHP RRSLKLILDF LGIAWSDAVL. It is sometimes possible for the material contained within the vial of "TPST2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
