SDS-PAGE
Protein-tyrosine sulfotransferase 2 Recombinant Protein | TPST2 recombinant protein
Recombinant Human Protein-tyrosine sulfotransferase 2
Gene Names
TPST2; TANGO13B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein-tyrosine sulfotransferase 2; Recombinant Human Protein-tyrosine sulfotransferase 2; Tyrosylprotein sulfotransferase 2; TPST-2; TPST2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
26-377aa; Full Length
Sequence
QQVLECRAVLAGLRSPRGAMRPEQEELVMVGTNHVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDYKTPANLKGYFQVNQNSTSSHLGSS
Sequence Length
377
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for TPST2 recombinant protein
Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.
Product Categories/Family for TPST2 recombinant protein
References
Existence of distinct tyrosylprotein sulfotransferase genes
molecular characterization of tyrosylprotein sulfotransferase-2.Beisswanger R., Corbeil D., Vannier C., Thiele C., Dohrmann U., Kellner R., Ashman K., Niehrs C., Huttner W.B.Proc. Natl. Acad. Sci. U.S.A. 95:11134-11139(1998)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
55.3 kDa
NCBI Official Full Name
protein-tyrosine sulfotransferase 2
NCBI Official Synonym Full Names
tyrosylprotein sulfotransferase 2
NCBI Official Symbol
TPST2
NCBI Official Synonym Symbols
TANGO13B
NCBI Protein Information
protein-tyrosine sulfotransferase 2
UniProt Protein Name
Protein-tyrosine sulfotransferase 2
Protein Family
UniProt Gene Name
TPST2
UniProt Synonym Gene Names
TPST-2
UniProt Entry Name
TPST2_HUMAN
NCBI Description
The protein encoded by this gene catalyzes the O-sulfation of tyrosine residues within acidic regions of proteins. The encoded protein is a type II integral membrane protein found in the Golgi body. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
TPST2: Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides. Belongs to the protein sulfotransferase family.
Protein type: EC 2.8.2.20; Endoplasmic reticulum; Transferase; Membrane protein, integral
Chromosomal Location of Human Ortholog: 22q12.1
Cellular Component: endoplasmic reticulum; Golgi apparatus; Golgi membrane; integral to membrane; membrane
Molecular Function: protein-tyrosine sulfotransferase activity
Biological Process: fusion of sperm to egg plasma membrane; peptidyl-tyrosine sulfation
Research Articles on TPST2
Similar Products
Product Notes
The TPST2 tpst2 (Catalog #AAA1116598) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-377aa; Full Length. The amino acid sequence is listed below: QQVLECRAVL AGLRSPRGAM RPEQEELVMV GTNHVEYRYG KAMPLIFVGG VPRSGTTLMR AMLDAHPEVR CGEETRIIPR VLAMRQAWSK SGREKLRLDE AGVTDEVLDA AMQAFILEVI AKHGEPARVL CNKDPFTLKS SVYLSRLFPN SKFLLMVRDG RASVHSMITR KVTIAGFDLS SYRDCLTKWN KAIEVMYAQC MEVGKEKCLP VYYEQLVLHP RRSLKLILDF LGIAWSDAVL HHEDLIGKPG GVSLSKIERS TDQVIKPVNL EALSKWTGHI PGDVVRDMAQ IAPMLAQLGY DPYANPPNYG NPDPFVINNT QRVLKGDYKT PANLKGYFQV NQNSTSSHLG SS. It is sometimes possible for the material contained within the vial of "Protein-tyrosine sulfotransferase 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
