Goat anti-Human, Mouse Toll-like receptor 4 Polyclonal Antibody | anti-TLR4 antibody
Toll-like receptor 4 polyclonal antibody
Gene Names
TLR4; TOLL; CD284; TLR-4; ARMD10
Reactivity
Human, Mouse
Applications
Immunocytochemistry, Immunohistochemistry, Western Blot
Purity
Epitope-Affinity purified IgG
Synonyms
Toll-like receptor 4; Polyclonal Antibody; Toll-like receptor 4 polyclonal antibody; anti-TLR4 antibody
Host
Goat
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Epitope-Affinity purified IgG
Form/Format
Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide
Applicable Applications for anti-TLR4 antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Immunogen
Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4)
Preparation and Storage
For long term storage, store at -20 degree C
For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles
Shipping: Shipped on Blue Ice
For maximum product recovery after thawing, centrifuge the vial before opening the cap. Avoid freeze/thaw cycles
Shipping: Shipped on Blue Ice
Product Categories/Family for anti-TLR4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
95,680 Da
NCBI Official Full Name
toll-like receptor 4 isoform C
NCBI Official Synonym Full Names
toll-like receptor 4
NCBI Official Symbol
TLR4
NCBI Official Synonym Symbols
TOLL; CD284; TLR-4; ARMD10
NCBI Protein Information
toll-like receptor 4; hToll; homolog of Drosophila toll
UniProt Protein Name
Toll-like receptor 4
Protein Family
UniProt Gene Name
TLR4
UniProt Entry Name
TLR4_HUMAN
Similar Products
Product Notes
The TLR4 tlr4 (Catalog #AAA566126) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. The Toll-like receptor 4 polyclonal antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Toll-like receptor 4 can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Researchers should empirically determine the suitability of the TLR4 tlr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Toll-like receptor 4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
