Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TNFRSF10A AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Rabbit anti-Human, Mouse TNFRSF10A Polyclonal Antibody | anti-TNFRSF10A antibody

TNFRSF10A antibody - C-terminal region

Gene Names
TNFRSF10A; DR4; APO2; CD261; TRAILR1; TRAILR-1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TNFRSF10A; Polyclonal Antibody; TNFRSF10A antibody - C-terminal region; anti-TNFRSF10A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDL
Sequence Length
468
Applicable Applications for anti-TNFRSF10A antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 80%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TNFRSF10A AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)

Western Blot (WB) (WB Suggested Anti-TNFRSF10A AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-TNFRSF10A antibody
This is a rabbit polyclonal antibody against TNFRSF10A. It was validated on Western Blot

Target Description: This is a receptor for the cytotoxic ligand TNFSF10/TRAIL. The adaptor molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappaB.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 10A
NCBI Official Synonym Full Names
TNF receptor superfamily member 10a
NCBI Official Symbol
TNFRSF10A
NCBI Official Synonym Symbols
DR4; APO2; CD261; TRAILR1; TRAILR-1
NCBI Protein Information
tumor necrosis factor receptor superfamily member 10A
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 10A
UniProt Gene Name
TNFRSF10A
UniProt Synonym Gene Names
APO2; DR4; TRAILR1; TRAIL receptor 1; TRAIL-R1
UniProt Entry Name
TR10A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein. [provided by RefSeq, Jul 2008]

Uniprot Description

TRAIL-R1: Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF- kappa-B.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 8p21

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; protease binding; death receptor activity; TRAIL binding; receptor activity; transcription factor binding

Biological Process: caspase activation; induction of apoptosis via death domain receptors; apoptosis; activation of NF-kappaB-inducing kinase; signal transduction

Research Articles on TNFRSF10A

Similar Products

Product Notes

The TNFRSF10A tnfrsf10a (Catalog #AAA3200258) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TNFRSF10A antibody - C-terminal region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TNFRSF10A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TNFRSF10A tnfrsf10a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RAGTAGPGDA LYAMLMKWVN KTGRNASIHT LLDALERMEE RHAKEKIQDL. It is sometimes possible for the material contained within the vial of "TNFRSF10A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.