Western Blot (WB)
(TMEM74 antibody (MBS5302971) used at 1 ug/ml to detect target protein.)
Rabbit TMEM74 Polyclonal Antibody | anti-TMEM74 antibody
TMEM74 antibody
Gene Names
TMEM74; NET36
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM74; Polyclonal Antibody; TMEM74 antibody; Polyclonal TMEM74; Anti-TMEM74; FLJ30668; TMEM-74; TMEM 74; Transmembrane Protein 74; anti-TMEM74 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
TMEM74 antibody was raised against the middle region of TMEM74
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM74 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
305
Applicable Applications for anti-TMEM74 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM74 plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction.
Cross-Reactivity
Human
Immunogen
TMEM74 antibody was raised using the middle region of TMEM74 corresponding to a region with amino acids ERLEKESARLGAHLDRCVIAGLCLLTLGGVILSCLLMMSMWKGELYRRNR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TMEM74 antibody (MBS5302971) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TMEM74 antibody (MBS5302971) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM74 antibody
Rabbit polyclonal TMEM74 antibody raised against the middle region of TMEM74
Product Categories/Family for anti-TMEM74 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
transmembrane protein 74
NCBI Official Synonym Full Names
transmembrane protein 74
NCBI Official Symbol
TMEM74
NCBI Official Synonym Symbols
NET36
NCBI Protein Information
transmembrane protein 74
UniProt Protein Name
Transmembrane protein 74
Protein Family
UniProt Gene Name
TMEM74
UniProt Entry Name
TMM74_HUMAN
Uniprot Description
TMEM74: Plays an essential role in autophagy. TMEM74-induced autophagy may involve PI3K signal transduction. Belongs to the TMEM74 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 8q23.1
Cellular Component: lysosomal membrane; integral to membrane; cytoplasmic vesicle
Biological Process: autophagy
Research Articles on TMEM74
Similar Products
Product Notes
The TMEM74 tmem74 (Catalog #AAA5302971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMEM74 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM74 tmem74 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM74, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
