Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMEM161A antibody (MBS5300761) used at 1 ug/ml to detect target protein.)

Rabbit TMEM161A Polyclonal Antibody | anti-TMEM161A antibody

TMEM161A antibody

Gene Names
TMEM161A; AROS-29
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMEM161A; Polyclonal Antibody; TMEM161A antibody; Polyclonal TMEM161A; Anti-TMEM161A; TMEM 161; TMEM161; TMEM-161; FLJ39645; AROS-29; FLJ20422; Transmembrane Protein 161A; anti-TMEM161A antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
TMEM161A antibody was raised against the middle region of TMEM161A
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TMEM161A antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
478
Applicable Applications for anti-TMEM161A antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
TMEM161A may be involved in the development of dendritic cells.
Cross-Reactivity
Human, Mouse, Rat
Immunogen
TMEM161A antibody was raised using the middle region of TMEM161A corresponding to a region with amino acids LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(TMEM161A antibody (MBS5300761) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (TMEM161A antibody (MBS5300761) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TMEM161A antibody
Rabbit polyclonal TMEM161A antibody raised against the middle region of TMEM161A
Product Categories/Family for anti-TMEM161A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
53 kDa (MW of target protein)
NCBI Official Full Name
TMEM161A protein, partial
NCBI Official Synonym Full Names
transmembrane protein 161A
NCBI Official Symbol
TMEM161A
NCBI Official Synonym Symbols
AROS-29
NCBI Protein Information
transmembrane protein 161A
UniProt Protein Name
Transmembrane protein 161A
UniProt Gene Name
TMEM161A
UniProt Synonym Gene Names
AROS-29
UniProt Entry Name
T161A_HUMAN

Uniprot Description

TMEM161A: Belongs to the TMEM161 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: integral to membrane

Biological Process: response to retinoic acid; positive regulation of DNA repair

Research Articles on TMEM161A

Similar Products

Product Notes

The TMEM161A tmem161a (Catalog #AAA5300761) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TMEM161A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TMEM161A tmem161a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TMEM161A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.