Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human APOA2 Monoclonal Antibody | anti-APOA2 antibody

APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (AP)

Gene Names
APOA2; apoAII; Apo-AII; ApoA-II
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
APOA2; Monoclonal Antibody; APOA2 (Apolipoprotein A-II; Apo-AII; ApoA-II; Apolipoprotein A2) (AP); anti-APOA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4F3
Specificity
Recognizes human APOA2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-APOA2 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-100 from human APOA2 (AAH05282) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of APOA2 expression in transfected 293T cell line by APOA2 monoclonal antibody. Lane 1: APOA2 transfected lysate (11.2kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of APOA2 expression in transfected 293T cell line by APOA2 monoclonal antibody. Lane 1: APOA2 transfected lysate (11.2kD). Lane 2: Non-transfected lysate)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to APOA2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to APOA2 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged APOA2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged APOA2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-APOA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
336
Molecular Weight
11,175 Da
NCBI Official Full Name
Homo sapiens apolipoprotein A-II, mRNA
NCBI Official Synonym Full Names
apolipoprotein A2
NCBI Official Symbol
APOA2
NCBI Official Synonym Symbols
apoAII; Apo-AII; ApoA-II
NCBI Protein Information
apolipoprotein A-II
Protein Family

NCBI Description

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008]

Research Articles on APOA2

Similar Products

Product Notes

The APOA2 (Catalog #AAA6130024) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The APOA2 (Apolipoprotein A-II, Apo-AII, ApoA-II, Apolipoprotein A2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APOA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOA2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APOA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.