Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Caldesmon 1 antibody (MBS5300453) used at 1 ug/ml to detect target protein.)

Rabbit Caldesmon 1 Polyclonal Antibody | anti-CALD1 antibody

Caldesmon 1 antibody

Gene Names
CALD1; CDM; HCAD; LCAD; H-CAD; L-CAD; NAG22
Applications
Western Blot
Purity
Affinity purified
Synonyms
Caldesmon 1; Polyclonal Antibody; Caldesmon 1 antibody; Polyclonal Caldesmon 1; Anti-Caldesmon 1; H-CAD; L-CAD; MGC21352; NAG22; CALD1; CDM; anti-CALD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Caldesmon 1 antibody was raised against the middle region of CALD1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CALD1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
538
Applicable Applications for anti-CALD1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CALD1 is a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction.
Cross-Reactivity
Human
Immunogen
Caldesmon 1 antibody was raised using the middle region of CALD1 corresponding to a region with amino acids FSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGD
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Caldesmon 1 antibody (MBS5300453) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Caldesmon 1 antibody (MBS5300453) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CALD1 antibody
Rabbit polyclonal Caldesmon 1 antibody raised against the middle region of CALD1
Product Categories/Family for anti-CALD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
800
Molecular Weight
63 kDa (MW of target protein)
NCBI Official Full Name
Caldesmon 1
NCBI Official Synonym Full Names
caldesmon 1
NCBI Official Symbol
CALD1
NCBI Official Synonym Symbols
CDM; HCAD; LCAD; H-CAD; L-CAD; NAG22
NCBI Protein Information
caldesmon
UniProt Protein Name
Caldesmon
Protein Family
UniProt Gene Name
CALD1
UniProt Synonym Gene Names
CAD; CDM; CDM
UniProt Entry Name
CALD1_HUMAN

NCBI Description

This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

Caldesmon: a cytoskeletal protein implicated in the regulation of actomyosin interactions in smooth muscle and nonmuscle cells. May act as a bridge between myosin and actin filaments. Stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, inhibits the actomyosin ATPase by binding to F-actin. This inhibition is attenuated by calcium-calmodulin and is potentiated by tropomyosin. Interacts with actin, myosin, two molecules of tropomyosin and with calmodulin. Also plays an essential role during cellular mitosis and receptor capping. Five alternatively spliced isoforms have been described.

Protein type: Actin-binding

Chromosomal Location of Human Ortholog: 7q33

Cellular Component: cytoskeleton; myofibril; plasma membrane; actin cap; cytosol; actin cytoskeleton

Molecular Function: calmodulin binding; myosin binding; actin binding; tropomyosin binding

Biological Process: muscle contraction; cell motility

Research Articles on CALD1

Similar Products

Product Notes

The CALD1 cald1 (Catalog #AAA5300453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Caldesmon 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CALD1 cald1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Caldesmon 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.