Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TMEM176B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Rabbit anti-Human, Mouse TMEM176B Polyclonal Antibody | anti-TMEM176B antibody
TMEM176B Rabbit pAb
Gene Names
TMEM176B; LR8
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
TMEM176B; Polyclonal Antibody; TMEM176B Rabbit pAb; LR8; MS4B2; anti-TMEM176B antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
NSFIWQTEPFLYIDTVCDRSDPVFPTTGYRWMRRSQENQWQKEECRAYMQMLRKLFTAIRA
Applicable Applications for anti-TMEM176B antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 148-208 of human TMEM176B (NP_054739.3).
Cellular Location
Multi-pass membrane protein, Nucleus membrane
Positive Samples
U-87MG, Mouse lung, Mouse liver
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TMEM176B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using TMEM176B antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,056 Da
NCBI Official Full Name
transmembrane protein 176B isoform a
NCBI Official Synonym Full Names
transmembrane protein 176B
NCBI Official Symbol
TMEM176B
NCBI Official Synonym Symbols
LR8
NCBI Protein Information
transmembrane protein 176B; LR8-like protein
UniProt Protein Name
Transmembrane protein 176B
Protein Family
UniProt Gene Name
TMEM176B
UniProt Synonym Gene Names
LR8
UniProt Entry Name
T176B_HUMAN
Similar Products
Product Notes
The TMEM176B tmem176b (Catalog #AAA9142188) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM176B Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM176B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TMEM176B tmem176b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NSFIWQTEPF LYIDTVCDRS DPVFPTTGYR WMRRSQENQW QKEECRAYMQ MLRKLFTAIR A. It is sometimes possible for the material contained within the vial of "TMEM176B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
