Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TMEM126B rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in human kidney.)

Rabbit anti-Human, Mouse TMEM126B Polyclonal Antibody | anti-TMEM126B antibody

TMEM126B (Transmembrane Protein 126B, HT007)

Gene Names
TMEM126B; HT007
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
TMEM126B; Polyclonal Antibody; TMEM126B (Transmembrane Protein 126B; HT007); Anti -TMEM126B (Transmembrane Protein 126B; anti-TMEM126B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TMEM126B. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE
Applicable Applications for anti-TMEM126B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TMEM126B, aa1-200 (NP_060950.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TMEM126B rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in human kidney.)

Western Blot (WB) (TMEM126B rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in human kidney.)

Western Blot (WB)

(TMEM126B rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in mouse spleen.)

Western Blot (WB) (TMEM126B rabbit polyclonal antibody. Western Blot analysis of TMEM126B expression in mouse spleen.)

Western Blot (WB)

(Western Blot analysis of TMEM126B expression in transfected 293T cell line by TMEM126B polyclonal antibody. Lane 1: TMEM126B transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TMEM126B expression in transfected 293T cell line by TMEM126B polyclonal antibody. Lane 1: TMEM126B transfected lysate (22.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TMEM126B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,943 Da
NCBI Official Full Name
transmembrane protein 126B isoform d
NCBI Official Synonym Full Names
transmembrane protein 126B
NCBI Official Symbol
TMEM126B
NCBI Official Synonym Symbols
HT007
NCBI Protein Information
transmembrane protein 126B
UniProt Protein Name
Transmembrane protein 126B
Protein Family
UniProt Gene Name
TMEM126B
UniProt Entry Name
T126B_HUMAN

Uniprot Description

TMEM126B: Belongs to the TMEM126 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q14.1

Cellular Component: mitochondrial membrane; integral to membrane

Similar Products

Product Notes

The TMEM126B tmem126b (Catalog #AAA6002673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM126B (Transmembrane Protein 126B, HT007) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM126B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TMEM126B tmem126b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASMHGQPS PSLEDAKLRR PMVIEIIEKN FDYLRKEMTQ NIYQMATFGT TAGFSGIFSN FLFRRCFKVK HDALKTYASL ATLPFLSTVV TDKLFVIDAL YSDNISKENC VFRSSLIGIV CGVFYPSSLA FTKNGRLATK YHTVPLPPKG RVLIHWMTLC QTQMKLMAIP LVFQIMFGIL NGLYHYAVFE ETLEKTIHEE. It is sometimes possible for the material contained within the vial of "TMEM126B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.