Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TMC6Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TMC6 Polyclonal Antibody | anti-TMC6 antibody

TMC6 Antibody - N-terminal region

Gene Names
TMC6; EV1; EVER1; EVIN1; LAK-4P
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TMC6; Polyclonal Antibody; TMC6 Antibody - N-terminal region; anti-TMC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLWRPEGTQSTATLRILASMPSRTIGRSRGAIISQYYNRTVQLRCRSSRP
Sequence Length
805
Applicable Applications for anti-TMC6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TMC6Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TMC6Sample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TMC6 antibody
Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 10 transmembrane domains and 2 leucine zipper motifs.
Product Categories/Family for anti-TMC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88 kDa
NCBI Official Full Name
transmembrane channel-like protein 6
NCBI Official Synonym Full Names
transmembrane channel like 6
NCBI Official Symbol
TMC6
NCBI Official Synonym Symbols
EV1; EVER1; EVIN1; LAK-4P
NCBI Protein Information
transmembrane channel-like protein 6
UniProt Protein Name
Transmembrane channel-like protein 6
UniProt Gene Name
TMC6
UniProt Synonym Gene Names
EVER1; EVIN1
UniProt Entry Name
TMC6_HUMAN

NCBI Description

Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 10 transmembrane domains and 2 leucine zipper motifs. [provided by RefSeq, Jul 2008]

Uniprot Description

TMC6: Defects in TMC6 are a cause of epidermodysplasia verruciformis (EV). It is a rare autosomal recessive genodermatosis associated with a high risk of skin carcinoma that results from an abnormal susceptibility to infection by specific human papillomaviruses. Infection leads to persistent wart-like or macular lesions. Belongs to the TMC family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; cytoplasm; integral to membrane

Molecular Function: protein binding

Biological Process: ion transport

Disease: Epidermodysplasia Verruciformis

Research Articles on TMC6

Similar Products

Product Notes

The TMC6 tmc6 (Catalog #AAA3222542) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMC6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMC6 tmc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLWRPEGTQS TATLRILASM PSRTIGRSRG AIISQYYNRT VQLRCRSSRP. It is sometimes possible for the material contained within the vial of "TMC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.