Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TMC8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit anti-Human TMC8 Polyclonal Antibody | anti-TMC8 antibody

TMC8 antibody - N-terminal region

Gene Names
TMC8; EV2; EVER2; EVIN2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMC8; Polyclonal Antibody; TMC8 antibody - N-terminal region; anti-TMC8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG
Sequence Length
726
Applicable Applications for anti-TMC8 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMC8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TMC8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-TMC8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-TMC8 antibody
This is a rabbit polyclonal antibody against TMC8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 8 predicted transmembrane domains and 3 leucine zipper motifs.
Product Categories/Family for anti-TMC8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
transmembrane channel-like protein 8
NCBI Official Synonym Full Names
transmembrane channel like 8
NCBI Official Symbol
TMC8
NCBI Official Synonym Symbols
EV2; EVER2; EVIN2
NCBI Protein Information
transmembrane channel-like protein 8
UniProt Protein Name
Transmembrane channel-like protein 8
UniProt Gene Name
TMC8
UniProt Synonym Gene Names
EVER2; EVIN2
UniProt Entry Name
TMC8_HUMAN

NCBI Description

Epidermodysplasia verruciformis (EV) is an autosomal recessive dermatosis characterized by abnormal susceptibility to human papillomaviruses (HPVs) and a high rate of progression to squamous cell carcinoma on sun-exposed skin. EV is caused by mutations in either of two adjacent genes located on chromosome 17q25.3. Both of these genes encode integral membrane proteins that localize to the endoplasmic reticulum and are predicted to form transmembrane channels. This gene encodes a transmembrane channel-like protein with 8 predicted transmembrane domains and 3 leucine zipper motifs. [provided by RefSeq, Jul 2008]

Uniprot Description

TMC8: an endoplasmic reticulum multipass membrane protein. Defects in TMC8 cause Lutz-Lewandowsky epidermodysplasia verruciformis [MIM:226400], a rare skin disease characterized by increased susceptibility to infection by papillomaviruses with an accompanying high risk of skin carcinoma. Three splice-variant isoforms of the human protein have been described.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: Golgi apparatus; extracellular space; endoplasmic reticulum membrane; nuclear membrane; endoplasmic reticulum; cytoplasm; integral to membrane

Molecular Function: protein binding; receptor binding

Biological Process: negative regulation of protein oligomerization; zinc ion homeostasis; ion transport; regulation of cell growth; negative regulation of protein binding

Disease: Epidermodysplasia Verruciformis

Research Articles on TMC8

Similar Products

Product Notes

The TMC8 tmc8 (Catalog #AAA3211083) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMC8 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TMC8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMC8 tmc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGPTLNLTLQ CPGSRQSPPG VLRFHNQLWH VLTGRAFTNT YLFYGAYRVG. It is sometimes possible for the material contained within the vial of "TMC8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.