Western Blot (WB)
(Host: RabbitTarget Name: MESDC1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TLNRD1 Polyclonal Antibody | anti-TLNRD1 antibody
TLNRD1 Antibody - N-terminal region
Gene Names
TLNRD1; MESDC1
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TLNRD1; Polyclonal Antibody; TLNRD1 Antibody - N-terminal region; anti-TLNRD1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIGGASSQPRKRLVSVCDHCKGKMQLVADLLLLSSEARPVLFEGPASSGA
Sequence Length
362
Applicable Applications for anti-TLNRD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MESDC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MESDC1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MESDC1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TLNRD1 antibody
This is a rabbit polyclonal antibody against MESDC1. It was validated on Western Blot
Target Description: This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects embryo patterning and the formation of heart, muscle, blood, skeleton and the urogenital system. The mouse gene is expressed in early development, and in the adult.
Target Description: This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects embryo patterning and the formation of heart, muscle, blood, skeleton and the urogenital system. The mouse gene is expressed in early development, and in the adult.
Product Categories/Family for anti-TLNRD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
talin rod domain-containing protein 1
NCBI Official Synonym Full Names
talin rod domain containing 1
NCBI Official Symbol
TLNRD1
NCBI Official Synonym Symbols
MESDC1
NCBI Protein Information
talin rod domain-containing protein 1
UniProt Protein Name
Talin rod domain-containing protein 1
UniProt Gene Name
TLNRD1
NCBI Description
This gene encodes a protein that is regulated by micro RNA MiR-574-3, and is thought to have an oncogenic function in human bladder cancer. A similar gene in mouse is located in a chromosomal region critical for differentiation of mesoderm, which affects embryo patterning and the formation of heart, muscle, blood, skeleton and the urogenital system. The mouse gene is expressed in early development, and in the adult. [provided by RefSeq, Nov 2016]
Uniprot Description
Actin-binding protein which may have an oncogenic function and regulates cell proliferation, migration and invasion in cancer cells.
Research Articles on TLNRD1
Similar Products
Product Notes
The TLNRD1 tlnrd1 (Catalog #AAA3217568) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TLNRD1 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TLNRD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TLNRD1 tlnrd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIGGASSQPR KRLVSVCDHC KGKMQLVADL LLLSSEARPV LFEGPASSGA. It is sometimes possible for the material contained within the vial of "TLNRD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
