Aquaporin-1 (AQP1) Recombinant Protein | AQP1 recombinant protein

Recombinant Human Aquaporin-1 (AQP1), partial

Cat. Num. AAA948542

• Gene Names: AQP1; CO; CHIP28; AQP-CHIP
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Aquaporin-1 (AQP1); Recombinant Human Aquaporin-1 (AQP1); partial; Aquaporin-CHIP; Urine water channel; Water channel protein for red blood cells and kidney proximal tubule; AQP1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 220-269. Partial
• Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for AQP1 recombinant protein

Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Product Categories/Family for AQP1 recombinant protein

Transport

References

Isolation of the cDNA for erythrocyte integral membrane protein of 28 kilodaltons member of an ancient channel family.Preston G.M., Agre P.Proc. Natl. Acad. Sci. U.S.A. 88:11110-11114(1991) The human aquaporin-CHIP gene. Structure, organization, and chromosomal localization.Moon C., Preston G.M., Griffin C.A., Jabs E.W., Agre P.J. Biol. Chem. 268:15772-15778(1993) Characterization of the 3' UTR sequence encoded by the AQP-1 gene in human retinal pigment epithelium.Ruiz A.C., Bok D.Biochim. Biophys. Acta 1282:174-178(1996) The water channel gene in human uterus.Li X., Yu H., Koide S.S.Biochem. Mol. Biol. Int. 32:371-377(1994) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) SeattleSNPs variation discovery resourceHuman protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B., Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017(2008) The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003)

NCBI and Uniprot Product Information

• NCBI GI #: 297307116
• NCBI GeneID: 358
• NCBI Accession #: NP_001171989.1
• NCBI GenBank Nucleotide #: NM_001185060.1
• UniProt Accession #: P29972; Q8TBI5; Q8TDC1; B5BU39; E7EM69; E9PC21; F5GY19
• Molecular Weight: 21.6 kDa
• NCBI Official Full Name: aquaporin-1 isoform 2
• NCBI Official Synonym Full Names: aquaporin 1 (Colton blood group)
• NCBI Official Symbol: AQP1
• NCBI Official Synonym Symbols: CO; CHIP28; AQP-CHIP
• NCBI Protein Information: aquaporin-1
• UniProt Protein Name: Aquaporin-1
• UniProt Gene Name: AQP1
• UniProt Synonym Gene Names: CHIP28; AQP-1
• UniProt Entry Name: AQP1_HUMAN

NCBI Description

Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This gene encodes an aquaporin which functions as a molecular water channel protein. It is a homotetramer with 6 bilayer spanning domains and N-glycosylation sites. The protein physically resembles channel proteins and is abundant in erythrocytes and renal tubes. The gene encoding this aquaporin is a possible candidate for disorders involving imbalance in ocular fluid movement. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

AQP1: Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Belongs to the MIP/aquaporin (TC 1.A.8) family.

Protein type: Transporter, aquaporin family; Membrane protein, multi-pass; Transporter; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p14

Cellular Component: apical part of cell; apical plasma membrane; basal plasma membrane; basolateral plasma membrane; brush border; brush border membrane; cytoplasm; integral to plasma membrane; nerve terminal; nuclear membrane; nucleus; plasma membrane; sarcolemma

Molecular Function: ammonium transmembrane transporter activity; ephrin receptor binding; glycerol channel activity; glycerol transmembrane transporter activity; intracellular cGMP activated cation channel activity; nitric oxide transporter activity; potassium channel activity; potassium ion transmembrane transporter activity; protein binding; transmembrane transporter activity; water channel activity; water transporter activity

Biological Process: adrenocorticotropin hormone secretion; ammonium transport; bicarbonate transport; camera-type eye morphogenesis; carbon dioxide transport; cell volume homeostasis; cellular homeostasis; cellular response to stress; cerebrospinal fluid secretion; cGMP biosynthetic process; establishment and/or maintenance of actin cytoskeleton polarity; glomerular filtration; glycerol transport; hyperosmotic salinity response; lateral ventricle development; lipid digestion; multicellular organismal water homeostasis; negative regulation of apoptosis; negative regulation of caspase activity; nitric oxide transport; odontogenesis; pancreatic juice secretion; positive regulation of angiogenesis; positive regulation of fibroblast proliferation; positive regulation of saliva secretion; potassium ion transport; renal water homeostasis; renal water transport; response to drug; response to estrogen stimulus; secretory granule organization and biogenesis; sensory perception of pain; transmembrane transport; water transport; wound healing

Disease: Blood Group--colton