Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDADC1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Horse, Human CDADC1 Polyclonal Antibody | anti-CDADC1 antibody

CDADC1 Antibody - C-terminal region

Gene Names
CDADC1; NYD-SP15; bA103J18.1
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDADC1; Polyclonal Antibody; CDADC1 Antibody - C-terminal region; anti-CDADC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EGVSKFTWQLNPSGAYGLEQNEPERRENGVLRPVPQKEEQHQDKKLRLGI
Sequence Length
514
Applicable Applications for anti-CDADC1 antibody
Western Blot (WB)
Homology
Horse: 90%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDADC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDADC1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDADC1Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDADC1 antibody
This is a rabbit polyclonal antibody against CDADC1. It was validated on Western Blot

Target Description: CDADC1 may play an important role in testicular development and spermatogenesis.
Product Categories/Family for anti-CDADC1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
cytidine and dCMP deaminase domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
cytidine and dCMP deaminase domain containing 1
NCBI Official Symbol
CDADC1
NCBI Official Synonym Symbols
NYD-SP15; bA103J18.1
NCBI Protein Information
cytidine and dCMP deaminase domain-containing protein 1
UniProt Protein Name
Cytidine and dCMP deaminase domain-containing protein 1
UniProt Gene Name
CDADC1
UniProt Entry Name
CDAC1_HUMAN

Research Articles on CDADC1

Similar Products

Product Notes

The CDADC1 cdadc1 (Catalog #AAA3217755) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDADC1 Antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDADC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDADC1 cdadc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EGVSKFTWQL NPSGAYGLEQ NEPERRENGV LRPVPQKEEQ HQDKKLRLGI. It is sometimes possible for the material contained within the vial of "CDADC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.