<
Western Blot (WB)
(Western Blot detection against Immunogen (37.73kD).)
Mouse anti-Human PRDM1 Monoclonal Antibody | anti-PRDM1 antibody
PRDM1 (PR Domain Zinc Finger Protein 1, BLIMP-1, Beta-interferon Gene Positive Regulatory Domain I-binding Factor, PR Domain-containing Protein 1, Positive Regulatory Domain I-binding Factor 1, PRDI-BF1, PRDI-binding Factor 1, BLIMP1) (FITC)
Gene Names
PRDM1; BLIMP1; PRDI-BF1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRDM1; Monoclonal Antibody; PRDM1 (PR Domain Zinc Finger Protein 1; BLIMP-1; Beta-interferon Gene Positive Regulatory Domain I-binding Factor; PR Domain-containing Protein 1; Positive Regulatory Domain I-binding Factor 1; PRDI-BF1; PRDI-binding Factor 1; BLIMP1) (FITC); anti-PRDM1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B10
Specificity
Recognizes human PRDM1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PRDM1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-109 from human PRDM1 (NP_001189) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELH
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37.73kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.73kD).)
Western Blot (WB)
(PRDM1 monoclonal antibody Western Blot analysis of PRDM1 expression in human spleen.)
Western Blot (WB)
(PRDM1 monoclonal antibody Western Blot analysis of PRDM1 expression in human spleen.)
Western Blot (WB)
(Western Blot analysis of PRDM1 expression in transfected 293T cell line by PRDM1 monoclonal antibody. Lane 1: PRDM1 transfected lysate (88kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of PRDM1 expression in transfected 293T cell line by PRDM1 monoclonal antibody. Lane 1: PRDM1 transfected lysate (88kD). Lane 2: Non-transfected lysate.)
Testing Data
(Detection limit for recombinant GST tagged PRDM1 is ~0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PRDM1 is ~0.3ng/ml as a capture antibody.)
Western Blot (WB)
(Western blot analysis of PRDM1 over-expressed 293 cell line, cotransfected with PRDM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRDM1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Western Blot (WB)
(Western blot analysis of PRDM1 over-expressed 293 cell line, cotransfected with PRDM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PRDM1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PRDM1 antibody
Transcriptional repressor that binds specifically to the PRDI element in the promoter of the beta-interferon gene. Drives the maturation of B-lymphocytes into Ig secreting cells.
Product Categories/Family for anti-PRDM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
76,835 Da
NCBI Official Full Name
PR domain zinc finger protein 1 isoform 1
NCBI Official Synonym Full Names
PR domain containing 1, with ZNF domain
NCBI Official Symbol
PRDM1
NCBI Official Synonym Symbols
BLIMP1; PRDI-BF1
NCBI Protein Information
PR domain zinc finger protein 1; BLIMP-1; PRDI-binding factor-1; B-lymphocyte-induced maturation protein 1; beta-interferon gene positive-regulatory domain I binding factor
UniProt Protein Name
PR domain zinc finger protein 1
Protein Family
UniProt Gene Name
PRDM1
UniProt Synonym Gene Names
BLIMP1; PRDI-BF1
UniProt Entry Name
PRDM1_HUMAN
NCBI Description
This gene encodes a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported. [provided by RefSeq, Jul 2008]
Research Articles on PRDM1
Similar Products
Product Notes
The PRDM1 prdm1 (Catalog #AAA6149020) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRDM1 (PR Domain Zinc Finger Protein 1, BLIMP-1, Beta-interferon Gene Positive Regulatory Domain I-binding Factor, PR Domain-containing Protein 1, Positive Regulatory Domain I-binding Factor 1, PRDI-BF1, PRDI-binding Factor 1, BLIMP1) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRDM1 prdm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRDM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
