Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (TIMP2 rabbit polyclonal antibody. Western Blot analysis of TIMP2 expression in mouse liver.)

Rabbit anti-Human, Mouse TIMP2 Polyclonal Antibody | anti-TIMP2 antibody

TIMP2 (Tissue Inhibitor of Metalloproteinases 2, TIMP-2, Metalloproteinase Inhibitor 2, CSC-21K, DDC8) APC

Gene Names
TIMP2; DDC8; CSC-21K
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TIMP2; Polyclonal Antibody; TIMP2 (Tissue Inhibitor of Metalloproteinases 2; TIMP-2; Metalloproteinase Inhibitor 2; CSC-21K; DDC8) APC; anti-TIMP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TIMP2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-TIMP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TIMP2, aa1-220 (NP_003246.1).
Immunogen Sequence
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TIMP2 rabbit polyclonal antibody. Western Blot analysis of TIMP2 expression in mouse liver.)

Western Blot (WB) (TIMP2 rabbit polyclonal antibody. Western Blot analysis of TIMP2 expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of TIMP2 expression in transfected 293T cell line by TIMP2 polyclonal antibody. Lane 1: TIMP2 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TIMP2 expression in transfected 293T cell line by TIMP2 polyclonal antibody. Lane 1: TIMP2 transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-TIMP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,399 Da
NCBI Official Full Name
metalloproteinase inhibitor 2
NCBI Official Synonym Full Names
TIMP metallopeptidase inhibitor 2
NCBI Official Symbol
TIMP2
NCBI Official Synonym Symbols
DDC8; CSC-21K
NCBI Protein Information
metalloproteinase inhibitor 2; TIMP-2; tissue inhibitor of metalloproteinase 2; tissue inhibitor of metalloproteinases 2
UniProt Protein Name
Metalloproteinase inhibitor 2
UniProt Gene Name
TIMP2
UniProt Synonym Gene Names
TIMP-2
UniProt Entry Name
TIMP2_HUMAN

NCBI Description

This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008]

Uniprot Description

TIMP2: Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. Interacts (via the C-terminal) with MMP2 (via the C- terminal PEX domain); the interaction inhibits the MMP2 activity. Down-regulated by TGFB1. Belongs to the protease inhibitor I35 (TIMP) family.

Protein type: Extracellular matrix; Inhibitor; Secreted; Motility/polarity/chemotaxis; Cell development/differentiation; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: proteinaceous extracellular matrix; extracellular space; cell surface; growth cone; cell soma; extracellular region; basement membrane

Molecular Function: metalloendopeptidase inhibitor activity; integrin binding; protein binding; protease binding; metal ion binding; enzyme activator activity

Biological Process: regulation of Rap protein signal transduction; response to drug; extracellular matrix organization and biogenesis; negative regulation of metalloenzyme activity; central nervous system development; response to hormone stimulus; negative regulation of membrane protein ectodomain proteolysis; negative regulation of cell proliferation; extracellular matrix disassembly; positive regulation of MAPKKK cascade; response to cytokine stimulus; negative regulation of Ras protein signal transduction; negative regulation of mitotic cell cycle; positive regulation of adenylate cyclase activity; positive regulation of neuron differentiation; aging

Research Articles on TIMP2

Similar Products

Product Notes

The TIMP2 timp2 (Catalog #AAA6396567) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TIMP2 (Tissue Inhibitor of Metalloproteinases 2, TIMP-2, Metalloproteinase Inhibitor 2, CSC-21K, DDC8) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TIMP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TIMP2 timp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TIMP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.