Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDKN1ASample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDKN1A Polyclonal Antibody | anti-CDKN1A antibody

CDKN1A Antibody - middle region

Gene Names
CDKN1A; P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDKN1A; Polyclonal Antibody; CDKN1A Antibody - middle region; anti-CDKN1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTD
Sequence Length
164
Applicable Applications for anti-CDKN1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDKN1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDKN1ASample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDKN1ASample Tissue: Human Hela Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDKN1A antibody
This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
cyclin-dependent kinase inhibitor 1 isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase inhibitor 1A
NCBI Official Symbol
CDKN1A
NCBI Official Synonym Symbols
P21; CIP1; SDI1; WAF1; CAP20; CDKN1; MDA-6; p21CIP1
NCBI Protein Information
cyclin-dependent kinase inhibitor 1
UniProt Protein Name
Cyclin-dependent kinase inhibitor 1
UniProt Gene Name
CDKN1A
UniProt Synonym Gene Names
CAP20; CDKN1; CIP1; MDA6; PIC1; SDI1; WAF1; MDA-6
UniProt Entry Name
CDN1A_HUMAN

NCBI Description

This gene encodes a potent cyclin-dependent kinase inhibitor. The encoded protein binds to and inhibits the activity of cyclin-cyclin-dependent kinase2 or -cyclin-dependent kinase4 complexes, and thus functions as a regulator of cell cycle progression at G1. The expression of this gene is tightly controlled by the tumor suppressor protein p53, through which this protein mediates the p53-dependent cell cycle G1 phase arrest in response to a variety of stress stimuli. This protein can interact with proliferating cell nuclear antigen, a DNA polymerase accessory factor, and plays a regulatory role in S phase DNA replication and DNA damage repair. This protein was reported to be specifically cleaved by CASP3-like caspases, which thus leads to a dramatic activation of cyclin-dependent kinase2, and may be instrumental in the execution of apoptosis following caspase activation. Mice that lack this gene have the ability to regenerate damaged or missing tissue. Multiple alternatively spliced variants have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

p21Cip1: a cell-cycle regulatory protein that Interacts with cyclin-CDK2 and -CDK4, inhibiting cell cycle progression at G1. Its expression is tightly controlled by p53, through which this protein mediates the p53-dependent cell cycle arrest at G1 phase.

Protein type: Inhibitor; Cell cycle regulation

Chromosomal Location of Human Ortholog: 6p21.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; perinuclear region of cytoplasm; cyclin-dependent protein kinase holoenzyme complex; nucleus; cytosol

Molecular Function: cyclin-dependent protein kinase inhibitor activity; cyclin binding; protein binding; cyclin-dependent protein kinase activating kinase activity; metal ion binding; ubiquitin protein ligase binding; protein complex binding

Biological Process: nerve growth factor receptor signaling pathway; response to arsenic; response to toxin; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; protein amino acid phosphorylation; negative regulation of cell proliferation; positive regulation of fibroblast proliferation; positive regulation of B cell proliferation; G2/M transition of mitotic cell cycle; cell cycle arrest; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; response to corticosterone stimulus; response to X-ray; response to drug; epidermal growth factor receptor signaling pathway; organ regeneration; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; negative regulation of cyclin-dependent protein kinase activity; response to organic nitrogen; positive regulation of programmed cell death; response to hyperoxia; positive regulation of protein kinase activity; Ras protein signal transduction; cellular response to extracellular stimulus; regulation of protein import into nucleus, translocation; innate immune response; negative regulation of phosphorylation; mitotic cell cycle; regulation of cyclin-dependent protein kinase activity; negative regulation of cell growth; response to DNA damage stimulus; negative regulation of apoptosis; G1/S transition of mitotic cell cycle

Research Articles on CDKN1A

Similar Products

Product Notes

The CDKN1A cdkn1a (Catalog #AAA3223014) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKN1A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDKN1A cdkn1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALLQGTAEED HVDLSLSCTL VPRSGEQAEG SPGGPGDSQG RKRRQTSMTD. It is sometimes possible for the material contained within the vial of "CDKN1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.