Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (THG1L polyclonal antibody. Western Blot analysis of THG1L expression in A-431.)

Mouse anti-Human THG1L Polyclonal Antibody | anti-THG1L antibody

THG1L (ICF45, Probable tRNA(His) Guanylyltransferase, Interphase Cytoplasmic Foci Protein 45, tRNA-histidine Guanylyltransferase, FLJ11601, FLJ20546)

Gene Names
THG1L; ICF45; IHG-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
THG1L; Polyclonal Antibody; THG1L (ICF45; Probable tRNA(His) Guanylyltransferase; Interphase Cytoplasmic Foci Protein 45; tRNA-histidine Guanylyltransferase; FLJ11601; FLJ20546); Anti -THG1L (ICF45; anti-THG1L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ICF45.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS
Applicable Applications for anti-THG1L antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ICF45, aa1-298 (AAH23521.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(THG1L polyclonal antibody. Western Blot analysis of THG1L expression in A-431.)

Western Blot (WB) (THG1L polyclonal antibody. Western Blot analysis of THG1L expression in A-431.)

Western Blot (WB)

(Western Blot analysis of THG1L expression in transfected 293T cell line by THG1L polyclonal antibody. Lane1: ICF45 transfected lysate (32.78kD). Lane2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of THG1L expression in transfected 293T cell line by THG1L polyclonal antibody. Lane1: ICF45 transfected lysate (32.78kD). Lane2: Non-transfected lysate.)
Related Product Information for anti-THG1L antibody
Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis.
Product Categories/Family for anti-THG1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34,831 Da
NCBI Official Full Name
THG1L protein
NCBI Official Synonym Full Names
tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
NCBI Official Symbol
THG1L
NCBI Official Synonym Symbols
ICF45; IHG-1
NCBI Protein Information
probable tRNA(His) guanylyltransferase; probable tRNA(His) guanylyltransferase; induced by high glucose-1; interphase cytoplasmic foci protein 45
UniProt Protein Name
Probable tRNA(His) guanylyltransferase
UniProt Gene Name
THG1L
UniProt Synonym Gene Names
ICF45
UniProt Entry Name
THG1_HUMAN

Uniprot Description

Function: Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis. Ref.8

Catalytic activity: p-tRNA(His) + ATP + GTP = pppG-P-tRNA(His) + AMP + diphosphate.

Cofactor: Binds 2 magnesium ions per subunit. Ref.8

Subunit structure: Homotetramer. Ref.8

Subcellular location: Cytoplasm. Note: Found near the nuclear membrane. Ref.1

Tissue specificity: Expressed in many tissues. Ref.1

Sequence similarities: Belongs to the tRNA(His) guanylyltransferase family.

Sequence caution: The sequence AAH01523.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAH01852.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Research Articles on THG1L

Similar Products

Product Notes

The THG1L thg1l (Catalog #AAA649305) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The THG1L (ICF45, Probable tRNA(His) Guanylyltransferase, Interphase Cytoplasmic Foci Protein 45, tRNA-histidine Guanylyltransferase, FLJ11601, FLJ20546) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THG1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the THG1L thg1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWGACKVKVH DSLATISITL RRYLRLGATM AKSKFEYVRD FEADDTCLAH CWVVVRLDGR NFHRFAEKHN FAKPNDSRAL QLMTKCAQTV MEELEDIVIA YGQSDEYSFV FKRKTNWFKR RASKFMTHVA SQFASSYVFY WRDYFEDQPL LYPPGFDGRV VVYPSNQTLK DYLSWRQADC HINNLYNTVF WALIQQSGLT PVQAQGRLQG TLAADKNEIL FSEFNINYNN EPPMYRKGTV LIWQKVDEVM TKEIKLPTEM EGKKMAVTRT RTKPVPLHCD IIGDAFWKEH PEILDEDS. It is sometimes possible for the material contained within the vial of "THG1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.