Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cationic trypsin Recombinant Protein

Recombinant Dog Cationic trypsin

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cationic trypsin; Recombinant Dog Cationic trypsin; Cationic trypsin recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-246aa; Full Length
Sequence
IVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLNSRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQISSNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVSPKVCKYVSWIQQTIAAN
Sequence Length
246
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.

SDS-PAGE

SDS-PAGE
Product Categories/Family for Cationic trypsin recombinant protein
References
"Differential regulation of trypsinogen mRNA translation: full-length mRNA sequences encoding two oppositely charged trypsinogen isoenzymes in the dog pancreas."Pinsky S.D., Laforge K.S., Scheele G.Mol. Cell. Biol. 5:2669-2676(1985)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
39.6 kDa
NCBI Official Full Name
Cationic trypsin
UniProt Protein Name
Cationic trypsin
Protein Family

Similar Products

Product Notes

The Cationic trypsin (Catalog #AAA7053556) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-246aa; Full Length. The amino acid sequence is listed below: IVGGYTCSRN SVPYQVSLNS GYHFCGGSLI NSQWVVSAAH CYKSRIQVRL GEYNIAVSEG GEQFINAAKI IRHPRYNANT IDNDIMLIKL SSPATLNSRV SAIALPKSCP AAGTQCLISG WGNTQSIGQN YPDVLQCLKA PILSDSVCRN AYPGQISSNM MCLGYMEGGK DSCQGDSGGP VVCNGELQGV VSWGAGCAQK GKPGVSPKVC KYVSWIQQTI AAN. It is sometimes possible for the material contained within the vial of "Cationic trypsin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.