Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-THEMIS AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit anti-Human THEMIS Polyclonal Antibody | anti-THEMIS antibody

THEMIS antibody - C-terminal region

Gene Names
THEMIS; GASP; SPOT; TSEPA; C6orf190; C6orf207
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THEMIS; Polyclonal Antibody; THEMIS antibody - C-terminal region; anti-THEMIS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKN
Sequence Length
606
Applicable Applications for anti-THEMIS antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-THEMIS AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-THEMIS AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-THEMIS antibody
This is a rabbit polyclonal antibody against THEMIS. It was validated on Western Blot

Target Description: THEMIS plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. It is required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. It regulates T-cell development through T-cell antigen receptor (TCR) signaling and in particular through the regulation of calcium influx and phosphorylation of Erk.
Product Categories/Family for anti-THEMIS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
protein THEMIS isoform 3
NCBI Official Synonym Full Names
thymocyte selection associated
NCBI Official Symbol
THEMIS
NCBI Official Synonym Symbols
GASP; SPOT; TSEPA; C6orf190; C6orf207
NCBI Protein Information
protein THEMIS
UniProt Protein Name
Protein THEMIS
Protein Family
UniProt Gene Name
THEMIS
UniProt Synonym Gene Names
C6orf190; C6orf207
UniProt Entry Name
THMS1_HUMAN

NCBI Description

This gene encodes a protein that plays a regulatory role in both positive and negative T-cell selection during late thymocyte development. The protein functions through T-cell antigen receptor signaling, and is necessary for proper lineage commitment and maturation of T-cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]

Uniprot Description

THEMIS: Plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. Required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells. Regulates T-cell development through T-cell antigen receptor (TCR) signaling and in particular through the regulation of calcium influx and phosphorylation of Erk. Interacts with PLCG1, ITK and GRB2. Belongs to the themis family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 6q22.33

Cellular Component: cytoplasm; intercellular junction; nucleus; signalosome

Molecular Function: protein binding

Biological Process: adaptive immune response; negative T cell selection; positive T cell selection; T cell receptor signaling pathway

Research Articles on THEMIS

Similar Products

Product Notes

The THEMIS themis (Catalog #AAA3216167) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THEMIS antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's THEMIS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THEMIS themis for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RHHVDITKKL HPNQAGLDSK VLIGSQNDLV DEEKERSNRG ATAIAETFKN. It is sometimes possible for the material contained within the vial of "THEMIS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.