Western Blot (WB)
(Host: RabbitTarget Name: TDRD9Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TDRD9 Polyclonal Antibody | anti-TDRD9 antibody
TDRD9 Antibody - C-terminal region
Gene Names
TDRD9; HLS; SPNE; HIG-1; NET54; SPGF30; C14orf75
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TDRD9; Polyclonal Antibody; TDRD9 Antibody - C-terminal region; anti-TDRD9 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHPDLVCLAPFADFDKQRYFRAQVLYVSGNSAEVFFVDYGNKSHVDLHLL
Sequence Length
1382
Applicable Applications for anti-TDRD9 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 89%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TDRD9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TDRD9Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TDRD9Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TDRD9 antibody
This is a rabbit polyclonal antibody against TDRD9. It was validated on Western Blot
Target Description: TDRD9 is a probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. TDRD9 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with PIWIL4 and the piP-bodies suggests a participation in the secondary piRNAs metabolic process.
Target Description: TDRD9 is a probable ATP-binding RNA helicase which plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. TDRD9 acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Its association with PIWIL4 and the piP-bodies suggests a participation in the secondary piRNAs metabolic process.
Product Categories/Family for anti-TDRD9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
152kDa
NCBI Official Full Name
ATP-dependent RNA helicase TDRD9
NCBI Official Synonym Full Names
tudor domain containing 9
NCBI Official Symbol
TDRD9
NCBI Official Synonym Symbols
HLS; SPNE; HIG-1; NET54; SPGF30; C14orf75
NCBI Protein Information
ATP-dependent RNA helicase TDRD9
UniProt Protein Name
Putative ATP-dependent RNA helicase TDRD9
Protein Family
UniProt Gene Name
TDRD9
UniProt Synonym Gene Names
C14orf75
UniProt Entry Name
TDRD9_HUMAN
Research Articles on TDRD9
Similar Products
Product Notes
The TDRD9 tdrd9 (Catalog #AAA3203172) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TDRD9 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's TDRD9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TDRD9 tdrd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHPDLVCLAP FADFDKQRYF RAQVLYVSGN SAEVFFVDYG NKSHVDLHLL. It is sometimes possible for the material contained within the vial of "TDRD9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
