Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ABP1 expression in NRK whole cell lysates (lane 1), 293T whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). ABP1 at 85KD was detected using rabbit anti- ABP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Rat ABP1 Polyclonal Antibody | anti-AOC1 antibody

Anti-ABP1 Antibody

Gene Names
AOC1; ABP; DAO; KAO; ABP1; DAO1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ABP1; Polyclonal Antibody; Anti-ABP1 Antibody; ABP; Abp1; AOC1; DAO; DAO1; Diamine oxidase; Histaminase; KAO; Kidney amine oxidase; P19801; Amiloride-sensitive amine oxidase [copper-containing]; amine oxidase; copper containing 1; anti-AOC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
751
Applicable Applications for anti-AOC1 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ABP1 (144-180aa STAEYALLYHTLQEATKPLHQFFLNTTGFSFQDCHDR), different from the related mouse sequence by ten amino acids, and from the related rat sequence by eight amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ABP1 expression in NRK whole cell lysates (lane 1), 293T whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). ABP1 at 85KD was detected using rabbit anti- ABP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of ABP1 expression in NRK whole cell lysates (lane 1), 293T whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). ABP1 at 85KD was detected using rabbit anti- ABP1 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-AOC1 antibody
Rabbit IgG polyclonal antibody for Amiloride-sensitive amine oxidase [copper-containing](AOC1) detection.
Background: This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function.
References
1. "Human kidney amiloride-binding protein: cDNA structure and functional expression."Barbry P., Champe M., Chassande O., Munemitsu S., Champigny G., Lingueglia E., Maes P., Frelin C., Tartar A., Ullrich A., Lazdunski M.Proc. Natl. Acad. Sci. U.S.A. 87: 7347-7351(1990).
2. "Structure and inhibition of human diamine oxidase."McGrath A.P., Hilmer K.M., Collyer C.A., Shepard E.M., Elmore B.O., Brown D.E., Dooley D.M., Guss J.M.Biochemistry 48: 9810-9822(2009).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
26
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,239 Da
NCBI Official Full Name
amiloride-sensitive amine oxidase
NCBI Official Synonym Full Names
amine oxidase, copper containing 1
NCBI Official Symbol
AOC1
NCBI Official Synonym Symbols
ABP; DAO; KAO; ABP1; DAO1
NCBI Protein Information
amiloride-sensitive amine oxidase [copper-containing]
UniProt Protein Name
Amiloride-sensitive amine oxidase [copper-containing]
Protein Family
UniProt Gene Name
AOC1
UniProt Synonym Gene Names
ABP1; DAO1; DAO; Diamine oxidase; KAO

NCBI Description

This gene encodes a metal-binding membrane glycoprotein that oxidatively deaminates putrescine, histamine, and related compounds. The encoded protein is inhibited by amiloride, a diuretic that acts by closing epithelial sodium ion channels. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2013]

Uniprot Description

ABP1: Catalyzes the degradation of compounds such as putrescine, histamine, spermine, and spermidine, substances involved in allergic and immune responses, cell proliferation, tissue differentiation, tumor formation, and possibly apoptosis. Placental DAO is thought to play a role in the regulation of the female reproductive function. Belongs to the copper/topaquinone oxidase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - histidine; Amino Acid Metabolism - tryptophan; EC 1.4.3.22; Oxidoreductase; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: extracellular space; plasma membrane; tight junction

Molecular Function: amine oxidase activity; calcium ion binding; copper ion binding; drug binding; heparin binding; protein complex binding; protein homodimerization activity; quinone binding; receptor activity; zinc ion binding

Biological Process: response to antibiotic; response to drug; xenobiotic metabolic process

Research Articles on AOC1

Similar Products

Product Notes

The AOC1 aoc1 (Catalog #AAA178796) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ABP1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ABP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the AOC1 aoc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ABP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.