Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: TCP1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Rabbit TCP1 Polyclonal Antibody | anti-TCP1 antibody

TCP1 antibody - C-terminal region

Gene Names
TCP1; CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCP1; Polyclonal Antibody; TCP1 antibody - C-terminal region; anti-TCP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAV
Sequence Length
556
Applicable Applications for anti-TCP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: TCP1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: TCP1Sample Tissue: Mouse HeartAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-TCP1 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-TCP1 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-TCP1 antibody
This is a rabbit polyclonal antibody against TCP1. It was validated on Western Blot

Target Description: The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.
Product Categories/Family for anti-TCP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
T-complex protein 1 subunit alpha isoform a
NCBI Official Synonym Full Names
t-complex 1
NCBI Official Symbol
TCP1
NCBI Official Synonym Symbols
CCT1; CCTa; D6S230E; CCT-alpha; TCP-1-alpha
NCBI Protein Information
T-complex protein 1 subunit alpha
UniProt Protein Name
T-complex protein 1 subunit alpha
Protein Family
UniProt Gene Name
TCP1
UniProt Synonym Gene Names
CCT1; CCTA; TCP-1-alpha
UniProt Entry Name
TCPA_HUMAN

NCBI Description

The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found. [provided by RefSeq, Jun 2010]

Uniprot Description

CCT-alpha: Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin. Heterooligomeric complex of about 850 to 900 kDa that forms two stacked rings, 12 to 16 nm in diameter. Interacts with PACRG. Component of the BBS/CCT complex composed at least of MKKS, BBS10, BBS12, TCP1, CCT2, CCT3, CCT4, CCT5 AND CCT8. Belongs to the TCP-1 chaperonin family.

Protein type: Chaperone; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6q25.3-q26

Cellular Component: chaperonin-containing T-complex; Golgi apparatus; centrosome; microtubule; pericentriolar material; acrosome; nuclear heterochromatin; cytosol

Molecular Function: protein binding; ubiquitin protein ligase binding; unfolded protein binding; ATP binding

Biological Process: tubulin folding; 'de novo' posttranslational protein folding; cellular protein metabolic process; protein folding; binding of sperm to zona pellucida

Research Articles on TCP1

Similar Products

Product Notes

The TCP1 tcp1 (Catalog #AAA3216108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCP1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TCP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCP1 tcp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QAGVFEPTIV KVKSLKFATE AAITILRIDD LIKLHPESKD DKHGSYEDAV. It is sometimes possible for the material contained within the vial of "TCP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.