Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TCF4Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse TCF4 Polyclonal Antibody | anti-TCF4 antibody

TCF4 Antibody - middle region

Gene Names
Tcf4; ME2; TFE; E2-2; E2.2; ITF2; SEF2; ITF-2; SEF-2; Tcf-4; ASP-I2; ITF-2b; SEF2-1; MITF-2A; MITF-2B; bHLHb19; 5730422P05Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
TCF4; Polyclonal Antibody; TCF4 Antibody - middle region; anti-TCF4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKD
Sequence Length
511
Applicable Applications for anti-TCF4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse TCF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TCF4Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TCF4Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TCF4 antibody
Transcription factor that binds to the immunoglobulin enhancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Isoform 2 inhibits MYOD1 activation of the cardiac alpha-actin promoter. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription. May have a regulatory function in developmental processes as well as during neuronal plasticity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56 kDa
NCBI Official Full Name
transcription factor 4 isoform b
NCBI Official Synonym Full Names
transcription factor 4
NCBI Official Symbol
Tcf4
NCBI Official Synonym Symbols
ME2; TFE; E2-2; E2.2; ITF2; SEF2; ITF-2; SEF-2; Tcf-4; ASP-I2; ITF-2b; SEF2-1; MITF-2A; MITF-2B; bHLHb19; 5730422P05Rik
NCBI Protein Information
transcription factor 4
UniProt Protein Name
Transcription factor 4
Protein Family
UniProt Gene Name
Tcf4
UniProt Synonym Gene Names
Itf2; Sef2; TCF-4; ITF-2; MITF-2; SEF-2
UniProt Entry Name
ITF2_MOUSE

Uniprot Description

Function: Transcription factor that binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Isoform 2 inhibits MYOD1 activation of the cardiac alpha-actin promoter. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription. May have a regulatory function in developmental processes as well as during neuronal plasticity. Ref.7

Subunit structure: Efficient DNA binding requires dimerization with another bHLH protein. Isoform 2 seems to form inactive heterodimers with MYOD1. The CTNNB1 and TCF4 complex interacts with PML. Identified in a complex with CTNNB1 and FERMT2

By similarity. Interacts with HIVEP2. Interacts with NEUROD2. Ref.6 Ref.7

Subcellular location: Nucleus

Probable.

Tissue specificity: Expressed in the cerebral cortex, Purkinje and granule cell layers of the cerebellum, olfactory neuroepithelium, pyramidal cells of hippocampal layers CA1-CA4, and in the granular cells of the dentate gyrus.

Developmental stage: Expressed in proliferative zones during development and in the adult in areas of neuronal plasticity. At embryonic day 12 (E12), expression is localized in the cortex, cerebellum, pons, medulla and spinal cord. From E18 to adulthood, high levels of expression are found in the pyramidal cells of hippocampal layers CA1-CA4, and in the granular cells of the dentate gyrus. At postnatal day 7, expression is high in the visual cortex and in the subependymal region extending from the anterior lateral ventricle into the olfactory bulb.

Sequence similarities: Contains 1 bHLH (basic helix-loop-helix) domain.

Research Articles on TCF4

Similar Products

Product Notes

The TCF4 tcf4 (Catalog #AAA3223587) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF4 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TCF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCF4 tcf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDPYRGMPPG LQGQSVSSGS SEIKSDDEGD ENLQDTKSSE DKKLDDDKKD. It is sometimes possible for the material contained within the vial of "TCF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.