Western Blot (WB)
(Host: RabbitTarget Name: TCF4Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TCF4 Polyclonal Antibody | anti-TCF4 antibody
TCF4 antibody - N-terminal region
Gene Names
TCF4; E2-2; ITF2; PTHS; SEF2; FECD3; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; bHLHb19
Reactivity
Guinea Pig, Horse, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TCF4; Polyclonal Antibody; TCF4 antibody - N-terminal region; anti-TCF4 antibody
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV
Sequence Length
667
Applicable Applications for anti-TCF4 antibody
Western Blot (WB)
Homology
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TCF4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TCF4Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TCF4Sample Type: HT1080 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-TCF4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-TCF4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Placenta)
Related Product Information for anti-TCF4 antibody
This is a rabbit polyclonal antibody against TCF4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.
Target Description: TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.
Product Categories/Family for anti-TCF4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
transcription factor 4 isoform b
NCBI Official Synonym Full Names
transcription factor 4
NCBI Official Symbol
TCF4
NCBI Official Synonym Symbols
E2-2; ITF2; PTHS; SEF2; FECD3; ITF-2; SEF-2; TCF-4; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; bHLHb19
NCBI Protein Information
transcription factor 4
UniProt Protein Name
Transcription factor 4
Protein Family
UniProt Gene Name
TCF4
UniProt Synonym Gene Names
BHLHB19; ITF2; SEF2; TCF-4; bHLHb19; ITF-2; SEF-2
UniProt Entry Name
ITF2_HUMAN
NCBI Description
This gene encodes transcription factor 4, a basic helix-loop-helix transcription factor. The encoded protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. This gene is broadly expressed, and may play an important role in nervous system development. Defects in this gene are a cause of Pitt-Hopkins syndrome. In addition, an intronic CTG repeat normally numbering 10-37 repeat units can expand to >50 repeat units and cause Fuchs endothelial corneal dystrophy. Multiple alternatively spliced transcript variants that encode different proteins have been described. [provided by RefSeq, Jul 2016]
Research Articles on TCF4
Similar Products
Product Notes
The TCF4 tcf4 (Catalog #AAA3224590) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TCF4 antibody - N-terminal region reacts with Guinea Pig, Horse, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TCF4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TCF4 tcf4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MHHQQRMAAL GTDKELSDLL DFSAMFSPPV SSGKNGPTSL ASGHFTGSNV. It is sometimes possible for the material contained within the vial of "TCF4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
