Western Blot (WB)
(Host: RabbitTarget Name: TBKBP1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TBKBP1 Polyclonal Antibody | anti-TBKBP1 antibody
TBKBP1 Antibody - C-terminal region
Gene Names
TBKBP1; SINTBAD; ProSAPiP2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TBKBP1; Polyclonal Antibody; TBKBP1 Antibody - C-terminal region; anti-TBKBP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTIRCASFCAGFPIPE
Sequence Length
615
Applicable Applications for anti-TBKBP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TBKBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TBKBP1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TBKBP1Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TBKBP1 antibody
This is a rabbit polyclonal antibody against TBKBP1. It was validated on Western Blot
Target Description: TBKBP1 is an adaptor protein that binds to TBK1 and is part of the interaction network in the TNF/NFKB pathway.
Target Description: TBKBP1 is an adaptor protein that binds to TBK1 and is part of the interaction network in the TNF/NFKB pathway.
Product Categories/Family for anti-TBKBP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
TANK-binding kinase 1-binding protein 1 isoform X1
NCBI Official Synonym Full Names
TBK1 binding protein 1
NCBI Official Symbol
TBKBP1
NCBI Official Synonym Symbols
SINTBAD; ProSAPiP2
NCBI Protein Information
TANK-binding kinase 1-binding protein 1
UniProt Protein Name
TANK-binding kinase 1-binding protein 1
Protein Family
UniProt Gene Name
TBKBP1
UniProt Synonym Gene Names
TBK1-binding protein 1
UniProt Entry Name
TBKB1_HUMAN
NCBI Description
TBKBP1 is an adaptor protein that binds to TBK1 (MIM 604834) and is part of the interaction network in the TNF (MIM 191160)/NFKB (see MIM 164011) pathway (Bouwmeester et al., 2004 [PubMed 14743216]).[supplied by OMIM, Mar 2008]
Uniprot Description
TBKBP1: Adapter protein which constitutively binds TBK1 and IKBKE and may play a role in antiviral innate immunity. Homodimer. May form a heterodimer with NAP1. Interacts with TKB1 and IKBKE. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 17q21.32
Molecular Function: protein binding
Biological Process: innate immune response
Research Articles on TBKBP1
Similar Products
Product Notes
The TBKBP1 tbkbp1 (Catalog #AAA3218959) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TBKBP1 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TBKBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBKBP1 tbkbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPRRAFEGIR LRFEKQPSEE DEWAVPTSPP SPEVGTIRCA SFCAGFPIPE. It is sometimes possible for the material contained within the vial of "TBKBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
