Western Blot (WB)
(WB Suggested Anti-TARP AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that TARP is expressed in Jurkat)
Rabbit TARP Polyclonal Antibody | anti-TARP antibody
TARP antibody - N-terminal region
Gene Names
TARP; CD3G; TCRG; TCRGV; TCRGC1; TCRGC2
Reactivity
Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TARP; Polyclonal Antibody; TARP antibody - N-terminal region; anti-TARP antibody
Host
Rabbit
Reactivity
Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK
Sequence Length
111
Applicable Applications for anti-TARP antibody
Western Blot (WB)
Homology
Horse: 86%; Human: 100%; Mouse: 86%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TARP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-TARP AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that TARP is expressed in Jurkat)
Western Blot (WB)
(WB Suggested Anti-TARP AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole CellThere is BioGPS gene expression data showing that TARP is expressed in Jurkat)
Related Product Information for anti-TARP antibody
This is a rabbit polyclonal antibody against TARP. It was validated on Western Blot
Target Description: In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG) locus is expressed. The resulting transcript contains a subset of the TRG gene segments and is shorter than TRG transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG locus transcript; the complete TRG locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG and its protein product is similar to TRG proteins. The upstream ORF uses a different reading frame and encodes a novel protein.
Target Description: In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG) locus is expressed. The resulting transcript contains a subset of the TRG gene segments and is shorter than TRG transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG locus transcript; the complete TRG locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG and its protein product is similar to TRG proteins. The upstream ORF uses a different reading frame and encodes a novel protein.
Product Categories/Family for anti-TARP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
TCR gamma alternate reading frame protein isoform 2
NCBI Official Symbol
TARP
NCBI Official Synonym Symbols
CD3G; TCRG; TCRGV; TCRGC1; TCRGC2
NCBI Protein Information
TCR gamma alternate reading frame protein
Protein Family
NCBI Description
In some non-lymphoid tissues, the unrearranged T cell receptor gamma (TRG@) locus is expressed. The resulting transcript contains a subset of the TRG@ gene segments and is shorter than TRG@ transcripts expressed in lymphoid tissues. This RefSeq record represents the unrearranged TRG@ locus transcript; the complete TRG@ locus is represented by the genomic RefSeq NG_001336. The transcript represented by this RefSeq has two open reading frames (ORFs) that encode different proteins. The downstream ORF is in the same frame as TRG@ and its protein product is similar to TRG@ proteins. The upstream ORF uses a different reading frame and encodes a novel protein. [provided by RefSeq, Jul 2008]
Research Articles on TARP
Similar Products
Product Notes
The TARP (Catalog #AAA3214948) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TARP antibody - N-terminal region reacts with Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TARP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TARP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YMKFSWLTVP EKSLDKEHRC IVRHENNKNG VDQEIIFPPI KTDVITMDPK. It is sometimes possible for the material contained within the vial of "TARP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
