Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CXorf40A AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCXorf40A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Rabbit CXorf40A Polyclonal Antibody | anti-CXORF40A antibody

CXorf40A Antibody - C-terminal region

Gene Names
CXorf40A; EOLA1; CXorf40
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CXorf40A; Polyclonal Antibody; CXorf40A Antibody - C-terminal region; anti-CXORF40A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDLTPDEVVELENQAVLTNLKQKYLTVISNPRWLLEPIPRKGGKDVFQVD
Sequence Length
158
Applicable Applications for anti-CXORF40A antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CXorf40A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CXorf40A AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCXorf40A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-CXorf40A AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellCXorf40A is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-CXORF40A antibody
This is a rabbit polyclonal antibody against CXorf40A. It was validated on Western Blot

Target Description: CXorf40A may have an important role of cell protection in inflammation reaction.
Product Categories/Family for anti-CXORF40A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
protein CXorf40A isoform a
NCBI Official Synonym Full Names
chromosome X open reading frame 40A
NCBI Official Symbol
CXorf40A
NCBI Official Synonym Symbols
EOLA1; CXorf40
NCBI Protein Information
protein CXorf40A
UniProt Protein Name
Protein CXorf40A
Protein Family
UniProt Gene Name
CXorf40A
UniProt Synonym Gene Names
CXorf40; EOLA1
UniProt Entry Name
CX04A_HUMAN

Research Articles on CXORF40A

Similar Products

Product Notes

The CXORF40A cxorf40a (Catalog #AAA3217154) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXorf40A Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CXorf40A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXORF40A cxorf40a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDLTPDEVVE LENQAVLTNL KQKYLTVISN PRWLLEPIPR KGGKDVFQVD. It is sometimes possible for the material contained within the vial of "CXorf40A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.