Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TAOK1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human TAOK1 Polyclonal Antibody | anti-TAOK1 antibody

TAOK1 Antibody - middle region

Gene Names
TAOK1; PSK2; TAO1; KFC-B; MARKK; PSK-2; hKFC-B; hTAOK1; MAP3K16
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TAOK1; Polyclonal Antibody; TAOK1 Antibody - middle region; anti-TAOK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SDDKSELDMMEGDHTVMSNSSVIHLKPEEENYREEGDPRTRASDPQSPPQ
Sequence Length
398
Applicable Applications for anti-TAOK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human TAOK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TAOK1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TAOK1Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TAOK1 antibody
This is a rabbit polyclonal antibody against TAOK1. It was validated on Western Blot

Target Description: TAOK1 is a Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. TAOK1 phosphorylates MAP2K3, MAP2K6 and MARK2. It acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. It is involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, It is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. TAOK1 acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. TAOK1 also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
serine/threonine-protein kinase TAO1 isoform 1
NCBI Official Synonym Full Names
TAO kinase 1
NCBI Official Symbol
TAOK1
NCBI Official Synonym Symbols
PSK2; TAO1; KFC-B; MARKK; PSK-2; hKFC-B; hTAOK1; MAP3K16
NCBI Protein Information
serine/threonine-protein kinase TAO1
UniProt Protein Name
Serine/threonine-protein kinase TAO1
UniProt Gene Name
TAOK1
UniProt Synonym Gene Names
KIAA1361; MAP3K16; MARKK; hKFC-B; MARKK; PSK-2; PSK2; Prostate-derived STE20-like kinase 2; TAOK1; hTAOK1
UniProt Entry Name
TAOK1_HUMAN

Uniprot Description

TAO1: Serine/threonine-protein kinase involved in various processes such as p38/MAPK14 stress-activated MAPK cascade, DNA damage response and regulation of cytoskeleton stability. Phosphorylates MAP2K3, MAP2K6 and MARK2. Acts as an activator of the p38/MAPK14 stress-activated MAPK cascade by mediating phosphorylation and subsequent activation of the upstream MAP2K3 and MAP2K6 kinases. Involved in G-protein coupled receptor signaling to p38/MAPK14. In response to DNA damage, involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of MAP2K3 and MAP2K6. Acts as a regulator of cytoskeleton stability by phosphorylating 'Thr-208' of MARK2, leading to activate MARK2 kinase activity and subsequent phosphorylation and detachment of MAPT/TAU from microtubules. Also acts as a regulator of apoptosis: regulates apoptotic morphological changes, including cell contraction, membrane blebbing and apoptotic bodies formation via activation of the MAPK8/JNK cascade. Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; Protein kinase, STE; Kinase, protein; STE group; STE20 family; TAO subfamily

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cytosol

Molecular Function: transferase activity; protein serine/threonine kinase activity; protein binding; MAP kinase kinase kinase activity; kinase activity; ATP binding; protein kinase activity

Biological Process: spindle checkpoint; activation of MAPKK activity; MAPKKK cascade; positive regulation of JNK cascade; mitotic cell cycle; DNA repair; G2/M transition DNA damage checkpoint; response to DNA damage stimulus; protein amino acid phosphorylation; positive regulation of stress-activated MAPK cascade; regulation of cytoskeleton organization and biogenesis

Research Articles on TAOK1

Similar Products

Product Notes

The TAOK1 taok1 (Catalog #AAA3219395) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAOK1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TAOK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAOK1 taok1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDDKSELDMM EGDHTVMSNS SVIHLKPEEE NYREEGDPRT RASDPQSPPQ. It is sometimes possible for the material contained within the vial of "TAOK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.