Western Blot (WB)
(Western Blot detection against Immunogen (50.86kD).)
Mouse anti-Human PPP2R3B Monoclonal Antibody | anti-PPP2R3B antibody
PPP2R3B (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit beta, PP2A Subunit B Isoform PR48, Protein Phosphatase 2A 48kD Regulatory Subunit, PPP2R3L, FLJ60425, NYREN8, PPP2R3LY) (FITC)
Gene Names
PPP2R3B; PR48; NYREN8; PPP2R3L; PPP2R3LY
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP2R3B; Monoclonal Antibody; PPP2R3B (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit beta; PP2A Subunit B Isoform PR48; Protein Phosphatase 2A 48kD Regulatory Subunit; PPP2R3L; FLJ60425; NYREN8; PPP2R3LY) (FITC); anti-PPP2R3B antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E12
Specificity
Recognizes human PPP2R3B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PPP2R3B antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant corresponding to aa1-226 from human PPP2R3B (AAH11180) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MIDRIFSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL*
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (50.86kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (50.86kD).)
Immunoprecipitation (IP)
(Immunoprecipitation of PPP2R3B transfected lysate using PPP2R3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP2R3B rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of PPP2R3B transfected lysate using PPP2R3B monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP2R3B rabbit polyclonal antibody.)
Related Product Information for anti-PPP2R3B antibody
The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
Product Categories/Family for anti-PPP2R3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
20,111 Da
NCBI Official Full Name
Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta, mRNA
NCBI Official Synonym Full Names
protein phosphatase 2 regulatory subunit B''beta
NCBI Official Symbol
PPP2R3B
NCBI Official Synonym Symbols
PR48; NYREN8; PPP2R3L; PPP2R3LY
NCBI Protein Information
serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta
Protein Family
NCBI Description
Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B'' family. The B'' family has been further divided into subfamilies. The product of this gene belongs to the beta subfamily of regulatory subunit B''. [provided by RefSeq, Apr 2010]
Research Articles on PPP2R3B
Similar Products
Product Notes
The PPP2R3B (Catalog #AAA6149012) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PPP2R3B (Serine/Threonine-protein Phosphatase 2A Regulatory Subunit B'' Subunit beta, PP2A Subunit B Isoform PR48, Protein Phosphatase 2A 48kD Regulatory Subunit, PPP2R3L, FLJ60425, NYREN8, PPP2R3LY) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP2R3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP2R3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP2R3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
