Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:30ug NIH3T3 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:TAF1BSubmitted by:Thomas Moss)

Rabbit TAF1B Polyclonal Antibody | anti-TAF1B antibody

TAF1B antibody - C-terminal region

Gene Names
Taf1b; p63; TAFI68; Tafi86; 4930408G01Rik; A230108M10Rik
Reactivity
Guinea Pig, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
TAF1B; Polyclonal Antibody; TAF1B antibody - C-terminal region; anti-TAF1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH
Sequence Length
586
Applicable Applications for anti-TAF1B antibody
Western Blot (WB)
Homology
Guinea Pig: 82%; Mouse: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse TAF1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:30ug NIH3T3 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:TAF1BSubmitted by:Thomas Moss)

Western Blot (WB) (Lanes:30ug NIH3T3 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:TAF1BSubmitted by:Thomas Moss)

Western Blot (WB)

(WB Suggested Anti-TAF1B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)

Western Blot (WB) (WB Suggested Anti-TAF1B Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: SP2/0 cell lysate)
Related Product Information for anti-TAF1B antibody
This is a rabbit polyclonal antibody against TAF1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TAF1b belongs to the family of TATA box binding protein (Tbp)-associated factors. Promoter selectivity for all three classes of eukaryotic RNA polymerases is brought about by multimeric protein complexes containing TATA box binding protein (TBP) and specific TBP-associated factors (TAFs).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
TATA box-binding protein-associated factor RNA polymerase I subunit B
NCBI Official Synonym Full Names
TATA-box binding protein associated factor, RNA polymerase I, B
NCBI Official Symbol
Taf1b
NCBI Official Synonym Symbols
p63; TAFI68; Tafi86; 4930408G01Rik; A230108M10Rik
NCBI Protein Information
TATA box-binding protein-associated factor RNA polymerase I subunit B
UniProt Protein Name
TATA box-binding protein-associated factor RNA polymerase I subunit B
UniProt Gene Name
Taf1b
UniProt Synonym Gene Names
TAFI68; TBP-associated factor 1B
UniProt Entry Name
TAF1B_MOUSE

Similar Products

Product Notes

The TAF1B taf1b (Catalog #AAA3203530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TAF1B antibody - C-terminal region reacts with Guinea Pig, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TAF1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAF1B taf1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQFILNIFSF LLRIKTSALH EEVSLLEKKL FEKKYNESKK SSGSKKGRRH. It is sometimes possible for the material contained within the vial of "TAF1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.