Western Blot (WB)
(WB Suggested Anti-Taf1b Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Heart)
Rabbit anti-Mouse, Rat Taf1b Polyclonal Antibody | anti-TAF1B antibody
Taf1b antibody - middle region
Gene Names
Taf1b; p63; TAFI68; Tafi86; 4930408G01Rik; A230108M10Rik
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Taf1b; Polyclonal Antibody; Taf1b antibody - middle region; anti-TAF1B antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK
Sequence Length
586
Applicable Applications for anti-TAF1B antibody
Western Blot (WB)
Homology
Mouse: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse Taf1b
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Taf1b Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Heart)
Western Blot (WB)
(WB Suggested Anti-Taf1b Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Mouse Heart)
Related Product Information for anti-TAF1B antibody
This is a rabbit polyclonal antibody against Taf1b. It was validated on Western Blot
Target Description: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.
Target Description: Component of the transcription factor SL1/TIF-IB complex, which is involved in the assembly of the PIC (preinitiation complex) during RNA polymerase I-dependent transcription. The rate of PIC formation probably is primarily dependent on the rate of association of SL1/TIF-IB with the rDNA promoter. SL1/TIF-IB is involved in stabilization of nucleolar transcription factor 1/UBTF on rDNA. Formation of SL1/TIF-IB excludes the association of TBP with TFIID subunits.
Product Categories/Family for anti-TAF1B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
TATA box-binding protein-associated factor RNA polymerase I subunit B
NCBI Official Synonym Full Names
TATA-box binding protein associated factor, RNA polymerase I, B
NCBI Official Symbol
Taf1b
NCBI Official Synonym Symbols
p63; TAFI68; Tafi86; 4930408G01Rik; A230108M10Rik
NCBI Protein Information
TATA box-binding protein-associated factor RNA polymerase I subunit B
UniProt Protein Name
TATA box-binding protein-associated factor RNA polymerase I subunit B
Protein Family
UniProt Gene Name
Taf1b
UniProt Synonym Gene Names
TAFI68; TBP-associated factor 1B
UniProt Entry Name
TAF1B_MOUSE
Similar Products
Product Notes
The TAF1B taf1b (Catalog #AAA3203531) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Taf1b antibody - middle region reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Taf1b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TAF1B taf1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYDVQAMAVI VVVLKLLFLL DDKLEWSYSD LAEAYNEQHR EDTPQFDFRK. It is sometimes possible for the material contained within the vial of "Taf1b, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
