Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SYTL5 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit SYTL5 Polyclonal Antibody | anti-SYTL5 antibody

SYTL5 Antibody - middle region

Gene Names
SYTL5; slp5
Reactivity
Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SYTL5; Polyclonal Antibody; SYTL5 Antibody - middle region; anti-SYTL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG
Sequence Length
921
Applicable Applications for anti-SYTL5 antibody
Western Blot (WB)
Homology
Horse: 93%; Human: 100%; Pig: 92%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human SYTL5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SYTL5 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-SYTL5 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-SYTL5 antibody
This is a rabbit polyclonal antibody against SYTL5. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the synaptotagmin-like (Slp) protein family, which contains a unique homology domain at the N-terminus, referred to as the Slp homology domain (SHD). The SHD functions as a binding site for Rab27A, which plays a role in protein transport. Expression of this gene is restricted to placenta and liver, suggesting that it might be involved in Rab27A-dependent membrane trafficking in specific tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-SYTL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
synaptotagmin-like 5, isoform CRA_c
NCBI Official Synonym Full Names
synaptotagmin like 5
NCBI Official Symbol
SYTL5
NCBI Official Synonym Symbols
slp5
NCBI Protein Information
synaptotagmin-like protein 5
UniProt Protein Name
Synaptotagmin-like protein 5
UniProt Gene Name
SYTL5
UniProt Synonym Gene Names
SLP5
UniProt Entry Name
SYTL5_HUMAN

NCBI Description

The protein encoded by this gene belongs to the synaptotagmin-like (Slp) protein family, which contains a unique homology domain at the N-terminus, referred to as the Slp homology domain (SHD). The SHD functions as a binding site for Rab27A, which plays a role in protein transport. Expression of this gene is restricted to placenta and liver, suggesting that it might be involved in Rab27A-dependent membrane trafficking in specific tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]

Uniprot Description

SYTL5: May act as Rab effector protein and play a role in vesicle trafficking. Binds phospholipids. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: Xp21.1

Cellular Component: membrane

Molecular Function: protein binding; metal ion binding; Rab GTPase binding

Biological Process: intracellular protein transport; exocytosis

Research Articles on SYTL5

Similar Products

Product Notes

The SYTL5 sytl5 (Catalog #AAA3217205) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYTL5 Antibody - middle region reacts with Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SYTL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYTL5 sytl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGAEEVQSQE QTRQDAEKSD TSPVAGKKAS HDGPKRKGFL LSKFRSATRG. It is sometimes possible for the material contained within the vial of "SYTL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.