Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SYT4Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse SYT4 Polyclonal Antibody | anti-SYT4 antibody

SYT4 Antibody - middle region

Gene Names
Syt4; SytIV
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
SYT4; Polyclonal Antibody; SYT4 Antibody - middle region; anti-SYT4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDI
Sequence Length
425
Applicable Applications for anti-SYT4 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SYT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SYT4Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SYT4Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SYT4 antibody
The protein encoded by this gene belongs to the synaptotagmin family. Members of this family are multi-domained, integral membrane proteins of synaptic vesicles, and are thought to serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis. This gene is primarily expressed in the nervous tissues.
Product Categories/Family for anti-SYT4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48 kDa
NCBI Official Full Name
synaptotagmin-4
NCBI Official Synonym Full Names
synaptotagmin IV
NCBI Official Symbol
Syt4
NCBI Official Synonym Symbols
SytIV
NCBI Protein Information
synaptotagmin-4
UniProt Protein Name
Synaptotagmin-4
Protein Family
UniProt Gene Name
Syt4
UniProt Synonym Gene Names
SytIV
UniProt Entry Name
SYT4_RAT

NCBI Description

The protein encoded by this gene belongs to the synaptotagmin family. Members of this family are multi-domained, integral membrane proteins of synaptic vesicles, and are thought to serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis. This gene is primarily expressed in the nervous tissues. [provided by RefSeq, Jul 2008]

Uniprot Description

SYT4: May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. Belongs to the synaptotagmin family.

Protein type: Vesicle; Calcium-binding; Membrane protein, integral

Cellular Component: synaptic vesicle; neuron projection; synaptic vesicle membrane; intracellular membrane-bound organelle; perinuclear region of cytoplasm; integral to membrane; plasma membrane; cell junction

Molecular Function: SNARE binding; clathrin binding; protein binding; syntaxin binding; calcium-dependent phospholipid binding; transporter activity; phosphatidylserine binding; calcium ion binding

Biological Process: negative regulation of vesicle fusion; negative regulation of calcium ion-dependent exocytosis; neurotransmitter secretion; calcium ion-dependent exocytosis

Research Articles on SYT4

Similar Products

Product Notes

The SYT4 syt4 (Catalog #AAA3223744) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYT4 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SYT4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYT4 syt4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HLPKSDVSGL SDPYVKVNLY HAKKRISKKK THVKKCTPNA VFNELFVFDI. It is sometimes possible for the material contained within the vial of "SYT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.