Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STX1ASample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse STX1A Polyclonal Antibody | anti-STX1A antibody

STX1A Antibody - N-terminal region

Gene Names
Stx1a; HPC-1
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
STX1A; Polyclonal Antibody; STX1A Antibody - N-terminal region; anti-STX1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENV
Sequence Length
288
Applicable Applications for anti-STX1A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse STX1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STX1ASample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STX1ASample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-STX1A antibody
Plays a role in hormone and neurotransmitter exocytosis (By similarity). Potentially involved in docking of synaptic vesicles at presynaptic active zones. May mediate Ca2+-regulation of exocytosis acrosomal reaction in sperm (PubMed:15774481).
Product Categories/Family for anti-STX1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
syntaxin-1A isoform 1
NCBI Official Synonym Full Names
syntaxin 1A (brain)
NCBI Official Symbol
Stx1a
NCBI Official Synonym Symbols
HPC-1
NCBI Protein Information
syntaxin-1A
UniProt Protein Name
Syntaxin-1A
Protein Family
UniProt Gene Name
Stx1a
UniProt Entry Name
STX1A_MOUSE

Uniprot Description

STX1A: a type IV membrane protein involved in docking of synaptic vesicles at presynaptic active zones. May play a critical role in neurotransmitter exocytosis. Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. Three splice variant isoforms have been described.

Protein type: Membrane protein, integral; Vesicle

Cellular Component: neuron projection; protein complex; synaptic vesicle membrane; cell; integral to membrane; actomyosin; endomembrane system; intracellular organelle; secretory granule; SNARE complex; synaptic vesicle; membrane; plasma membrane; synapse; cytoplasmic vesicle; intracellular; cell junction

Molecular Function: protein binding, bridging; SNAP receptor activity; protein domain specific binding; ATP-dependent protein binding; SNARE binding; protein binding; chloride channel inhibitor activity; myosin binding; protein heterodimerization activity; myosin head/neck binding; protein N-terminus binding; calcium channel inhibitor activity; glycoprotein binding; calcium-dependent protein binding; kinase binding

Biological Process: response to gravity; exocytosis; positive regulation of neurotransmitter secretion; calcium ion-dependent exocytosis; synaptic vesicle fusion to presynaptic membrane; vesicle-mediated transport; regulation of exocytosis; intracellular protein transport; vesicle docking; transport; neurotransmitter transport; secretion by cell; positive regulation of exocytosis

Research Articles on STX1A

Similar Products

Product Notes

The STX1A stx1a (Catalog #AAA3223708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STX1A Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's STX1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STX1A stx1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KDRTQELRTA KDSDDDDDVT VTVDRDRFMD EFFEQVEEIR GFIDKIAENV. It is sometimes possible for the material contained within the vial of "STX1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.