Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SYMPK expression in transfected 293T cell line by SYMPK polyclonal antibody. Lane 1: SYMPK transfected lysate (58.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Symplekin Polyclonal Antibody | anti-SYMPK antibody

Symplekin (SYMPK, SPK, SYM)

Gene Names
SYMPK; SPK; SYM
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Symplekin; Polyclonal Antibody; Symplekin (SYMPK; SPK; SYM); Anti -Symplekin (SYMPK; anti-SYMPK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SYMPK.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPR
Applicable Applications for anti-SYMPK antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SYMPK, aa1-533 (AAH30214.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SYMPK expression in transfected 293T cell line by SYMPK polyclonal antibody. Lane 1: SYMPK transfected lysate (58.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SYMPK expression in transfected 293T cell line by SYMPK polyclonal antibody. Lane 1: SYMPK transfected lysate (58.9kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SYMPK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141,148 Da
NCBI Official Full Name
symplekin
NCBI Official Synonym Full Names
symplekin
NCBI Official Symbol
SYMPK
NCBI Official Synonym Symbols
SPK; SYM
NCBI Protein Information
symplekin
UniProt Protein Name
Symplekin
Protein Family
UniProt Gene Name
SYMPK
UniProt Synonym Gene Names
SPK
UniProt Entry Name
SYMPK_HUMAN

NCBI Description

This gene encodes a nuclear protein that functions in the regulation of polyadenylation and promotes gene expression. The protein forms a high-molecular weight complex with components of the polyadenylation machinery. It is thought to serve as a scaffold for recruiting regulatory factors to the polyadenylation complex. It also participates in 3'-end maturation of histone mRNAs, which do not undergo polyadenylation. The protein also localizes to the cytoplasmic plaques of tight junctions in some cell types. [provided by RefSeq, Jul 2008]

Uniprot Description

Symplekin: Heat-labile component of a multimolecular complex that function in histone mRNA 3'-end processing. Specific component of the tight junction (TJ) plaque, but might not be an exclusively junctional component. May have a house-keeping rule. May be required for pre-mRNA polyadenylation. Found in a heat-sensitive complex at least composed of several cleavage and polyadenylation specific and cleavage stimulation factors. Interacts with CPSF2, CPSF3 and CSTF2. Interacts with HSF1 in heat-stressed cells. In testis, expressed in polar epithelia and Sertoli cells but not in vascular endothelia. The protein is detected in stomach, duodenum, pancreas, liver, fetal brain, carcinomas, lens-forming cells, fibroblasts, lymphocytes, lymphoma cells, erythroleukemia cells but not in endothelium of vessels, epidermis, intercalated disks, Purkinje fiber cells of the heart and lymph node. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; RNA processing

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: nucleoplasm; tight junction; cytoskeleton; cytoplasm; plasma membrane

Molecular Function: protein binding

Biological Process: mRNA polyadenylation; cell adhesion; positive regulation of protein amino acid dephosphorylation

Research Articles on SYMPK

Similar Products

Product Notes

The SYMPK sympk (Catalog #AAA6002347) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Symplekin (SYMPK, SPK, SYM) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Symplekin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the SYMPK sympk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASGSGDSVT RRSVASQFFT QEEGPGIDGM TTSERVVDLL NQAALITNDS KITVLKQVQE LIINKDPTLL DNFLDEIIAF QADKSIEVRK FVIGFIEEAC KRDIELLLKL IANLNMLLRD ENVNVVKKAI LTMTQLYKVA LQWMVKSRVI SELQEACWDM VSAMAGDIIL LLDSDNDGIR THAIKFVEGL IVTLSPRMAD SEIPRRQEHD ISLDRIPRDH PYIQYNVLWE EGKAALEQLL KFMVHPAISS INLTTALGSL ANIARQRPMF MSEVIQAYET LHANLPPTLA KSQVSSVRKN LKLHLLSVLK HPASLEFQAQ ITTLLVDLGT PQAEIARNMP SSKDTRKRPR DDSDSTLKKM KLEPNLGEDD EDKDLEPGPS GTSKASAQIS GQSDTDITAE FLQPLLTPDN VANLVLISMV YLPEAMPASF QAIYTPVESA GTEAQIKHLA RLMATQMTAA GLGPGVEQTK QCKEEPKEEK VVKTESVLIK RRLSAQGQAI SVVGSLSSMS PLEEEAPQAK RRPEPIIPVT QPR. It is sometimes possible for the material contained within the vial of "Symplekin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.