Western Blot (WB)
(Host: RabbitTarget Name: SUPT6HSample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit SUPT6H Polyclonal Antibody | anti-SUPT6H antibody
SUPT6H Antibody - C-terminal region
Gene Names
SUPT6H; SPT6; SPT6H; emb-5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SUPT6H; Polyclonal Antibody; SUPT6H Antibody - C-terminal region; anti-SUPT6H antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIEST
Sequence Length
1726
Applicable Applications for anti-SUPT6H antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SUPT6H
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SUPT6HSample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SUPT6HSample Type: Colorectal Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SUPT6H antibody
This is a rabbit polyclonal antibody against SUPT6H. It was validated on Western Blot
Target Description: SUPT6H may be functionally analogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintenance of chromatin structure. Spt6 may also participates in the regulation of transcription by RNA polymerase II (RNAPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNAPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF).
Target Description: SUPT6H may be functionally analogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintenance of chromatin structure. Spt6 may also participates in the regulation of transcription by RNA polymerase II (RNAPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNAPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF).
Product Categories/Family for anti-SUPT6H antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
199kDa
NCBI Official Full Name
SUPT6H protein
NCBI Official Synonym Full Names
SPT6 homolog, histone chaperone and transcription elongation factor
NCBI Official Symbol
SUPT6H
NCBI Official Synonym Symbols
SPT6; SPT6H; emb-5
NCBI Protein Information
transcription elongation factor SPT6
UniProt Protein Name
Transcription elongation factor SPT6
UniProt Gene Name
SUPT6H
UniProt Synonym Gene Names
KIAA0162; SPT6H
UniProt Entry Name
SPT6H_HUMAN
Research Articles on SUPT6H
Similar Products
Product Notes
The SUPT6H supt6h (Catalog #AAA3203987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SUPT6H Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SUPT6H can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SUPT6H supt6h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQQQPKSNSH AAIDWGKMAE QWLQEKEAER RKQKQRLTPR PSPSPMIEST. It is sometimes possible for the material contained within the vial of "SUPT6H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
