Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STK17ASample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit STK17A Polyclonal Antibody | anti-STK17A antibody

STK17A Antibody - C-terminal region

Gene Names
STK17A; DRAK1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
STK17A; Polyclonal Antibody; STK17A Antibody - C-terminal region; anti-STK17A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQE
Sequence Length
414
Applicable Applications for anti-STK17A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human STK17A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STK17ASample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STK17ASample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-STK17A antibody
This is a rabbit polyclonal antibody against STK17A. It was validated on Western Blot

Target Description: This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
serine/threonine-protein kinase 17A
NCBI Official Synonym Full Names
serine/threonine kinase 17a
NCBI Official Symbol
STK17A
NCBI Official Synonym Symbols
DRAK1
NCBI Protein Information
serine/threonine-protein kinase 17A
UniProt Protein Name
Serine/threonine-protein kinase 17A
UniProt Gene Name
STK17A
UniProt Synonym Gene Names
DRAK1
UniProt Entry Name
ST17A_HUMAN

NCBI Description

This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity. [provided by RefSeq, Jul 2008]

Uniprot Description

DRAK1: a calmodulin-dependent kinase of the DAPK family. Interacts with and is regulated by calcineurin homologous protein (CHP), an EF-hand Ca(2+)-binding protein. In vitro, CHP inhibits the apoptosis-inducing protein kinase DRAK2 in the presence of elevated Ca(2+) levels. Highly expressed in placenta, lung, pancreas. Lower levels in heart, brain, liver, skeletal muscle and kidney.

Protein type: Kinase, protein; Protein kinase, CAMK; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); CAMK group; DAPK family

Chromosomal Location of Human Ortholog: 7p13

Cellular Component: nucleus

Molecular Function: protein serine/threonine kinase activity; ATP binding

Biological Process: apoptosis; positive regulation of apoptosis; protein amino acid phosphorylation

Research Articles on STK17A

Similar Products

Product Notes

The STK17A stk17a (Catalog #AAA3214096) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STK17A Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STK17A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STK17A stk17a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KSETKESIVT EELIVVTSYT LGQCRQSEKE KMEQKAISKR FKFEEPLLQE. It is sometimes possible for the material contained within the vial of "STK17A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.