Western Blot (WB)
(Host: RabbitTarget Name: AKAP8LSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit AKAP8L Polyclonal Antibody | anti-AKAP8L antibody
AKAP8L Antibody - C-terminal region
Gene Names
AKAP8L; HA95; HAP95; NAKAP; NAKAP95
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AKAP8L; Polyclonal Antibody; AKAP8L Antibody - C-terminal region; anti-AKAP8L antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISE
Sequence Length
585
Applicable Applications for anti-AKAP8L antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 82%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AKAP8L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: AKAP8LSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: AKAP8LSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AKAP8L antibody
This is a rabbit polyclonal antibody against AKAP8L. It was validated on Western Blot
Target Description: AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. It does not seem to be implicated in the binding of regulatory subunit II of PKA. It may be involved in nuclear envelope breakdown and chromatin condensation. It may regulate the initiation phase of DNA replication when associated with TMPO-beta.
Target Description: AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. It does not seem to be implicated in the binding of regulatory subunit II of PKA. It may be involved in nuclear envelope breakdown and chromatin condensation. It may regulate the initiation phase of DNA replication when associated with TMPO-beta.
Product Categories/Family for anti-AKAP8L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
A-kinase anchor protein 8-like isoform 1
NCBI Official Synonym Full Names
A-kinase anchoring protein 8 like
NCBI Official Symbol
AKAP8L
NCBI Official Synonym Symbols
HA95; HAP95; NAKAP; NAKAP95
NCBI Protein Information
A-kinase anchor protein 8-like
UniProt Protein Name
A-kinase anchor protein 8-like
Protein Family
UniProt Gene Name
AKAP8L
UniProt Synonym Gene Names
NAKAP; NAKAP95; AKAP8-like protein; HAP95; HA95; Neighbor of AKAP95
UniProt Entry Name
AKP8L_HUMAN
Uniprot Description
AKAP8L: Could play a role in constitutive transport element (CTE)-mediated gene expression. Does not seem to be implicated in the binding of regulatory subunit II of PKA. May be involved in nuclear envelope breakdown and chromatin condensation. May regulate the initiation phase of DNA replication when associated with TMPO-beta. Belongs to the AKAP95 family.
Protein type: RNA-binding; Adaptor/scaffold
Chromosomal Location of Human Ortholog: 19p13.12
Cellular Component: nucleoplasm; nuclear matrix; cytoplasm; nucleus
Molecular Function: protein binding; DEAD/H-box RNA helicase binding; DNA binding; metal ion binding
Research Articles on AKAP8L
Similar Products
Product Notes
The AKAP8L akap8l (Catalog #AAA3200613) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKAP8L Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP8L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKAP8L akap8l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNKLISKKLE RYLKGENPFT DSPEEEKEQE EAEGGALDEG AQGEAAGISE. It is sometimes possible for the material contained within the vial of "AKAP8L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
