Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SULT1B1Sample Tissue: Human Stomach TumorAntibody Dilution: 1ug/ml)

Rabbit SULT1B1 Polyclonal Antibody | anti-SULT1B1 antibody

SULT1B1 antibody - N-terminal region

Gene Names
SULT1B1; ST1B1; ST1B2; SULT1B2
Reactivity
Cow, Dog, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SULT1B1; Polyclonal Antibody; SULT1B1 antibody - N-terminal region; anti-SULT1B1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG
Sequence Length
296
Applicable Applications for anti-SULT1B1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Human: 100%; Pig: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SULT1B1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SULT1B1Sample Tissue: Human Stomach TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SULT1B1Sample Tissue: Human Stomach TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-SULT1B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Intestine)

Western Blot (WB) (WB Suggested Anti-SULT1B1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Intestine)
Related Product Information for anti-SULT1B1 antibody
This is a rabbit polyclonal antibody against SULT1B1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes.
Product Categories/Family for anti-SULT1B1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
sulfotransferase family cytosolic 1B member 1
NCBI Official Synonym Full Names
sulfotransferase family 1B member 1
NCBI Official Symbol
SULT1B1
NCBI Official Synonym Symbols
ST1B1; ST1B2; SULT1B2
NCBI Protein Information
sulfotransferase family cytosolic 1B member 1
UniProt Protein Name
Sulfotransferase family cytosolic 1B member 1
UniProt Gene Name
SULT1B1
UniProt Synonym Gene Names
ST1B2; SULT1B2; ST1B1; Sulfotransferase 1B1; ST1B2
UniProt Entry Name
ST1B1_HUMAN

NCBI Description

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. However, the total genomic length of this gene is greater than that of other SULT1 genes. [provided by RefSeq, Jul 2008]

Uniprot Description

SULT1B1: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine. Belongs to the sulfotransferase 1 family.

Protein type: Transferase; EC 2.8.2.-

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: cytosol

Molecular Function: sulfotransferase activity; aryl sulfotransferase activity

Biological Process: steroid metabolic process; biogenic amine metabolic process; flavonoid metabolic process; epithelial cell differentiation; xenobiotic metabolic process; sulfation; 3'-phosphoadenosine 5'-phosphosulfate metabolic process; thyroid hormone metabolic process; phenol metabolic process

Research Articles on SULT1B1

Similar Products

Product Notes

The SULT1B1 sult1b1 (Catalog #AAA3209155) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SULT1B1 antibody - N-terminal region reacts with Cow, Dog, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SULT1B1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SULT1B1 sult1b1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MLSPKDILRK DLKLVHGYPM TCAFASNWEK IEQFHSRPDD IVIATYPKSG. It is sometimes possible for the material contained within the vial of "SULT1B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.