Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (STRADA MaxPab rabbit polyclonal antibody. Western Blot analysis of STRADA expression in human kidney.)

Rabbit anti-Human STRADA Polyclonal Antibody | anti-STRADA antibody

STRADA (STE20-Related Kinase Adaptor alpha, FLJ90524, LYK5, NY-BR-96, PMSE, STRAD, Stlk) (HRP)

Gene Names
STRADA; LYK5; PMSE; Stlk; STRAD; NY-BR-96; STRAD alpha
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
STRADA; Polyclonal Antibody; STRADA (STE20-Related Kinase Adaptor alpha; FLJ90524; LYK5; NY-BR-96; PMSE; STRAD; Stlk) (HRP); STE20-Related Kinase Adaptor alpha; Stlk; anti-STRADA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human STRADA.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
348
Applicable Applications for anti-STRADA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
STRADA (NP_699166.2, 1aa-348aa) full-length human protein.
Immunogen Sequence
MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFKDMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARYPCWPGPGLRESRGCSGG
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.

Western Blot (WB)

(STRADA MaxPab rabbit polyclonal antibody. Western Blot analysis of STRADA expression in human kidney.)

Western Blot (WB) (STRADA MaxPab rabbit polyclonal antibody. Western Blot analysis of STRADA expression in human kidney.)
Product Categories/Family for anti-STRADA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
STE20-related kinase adapter protein alpha isoform 3
NCBI Official Synonym Full Names
STE20 related adaptor alpha
NCBI Official Symbol
STRADA
NCBI Official Synonym Symbols
LYK5; PMSE; Stlk; STRAD; NY-BR-96; STRAD alpha
NCBI Protein Information
STE20-related kinase adapter protein alpha
UniProt Protein Name
STE20-related kinase adapter protein alpha
UniProt Gene Name
STRADA
UniProt Synonym Gene Names
LYK5; STRAD; STRAD alpha
UniProt Entry Name
STRAA_HUMAN

NCBI Description

The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a 'pseudokinase'. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. [provided by RefSeq, Sep 2009]

Uniprot Description

STRAD: a pseudokinase which, in complex with CAB39, binds to and activates LKB1. Relocates LKB1 from the nucleus to the cytoplasm. Plays an essential role in LKB1-mediated G1 cell cycle arrest. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); Protein kinase, STE; STE group; STE20 family; STLK subfamily

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: nucleoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activator activity; protein binding; kinase binding; protein kinase activator activity; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: activation of protein kinase activity; insulin receptor signaling pathway; mitotic cell cycle; protein export from nucleus; cell cycle arrest; protein amino acid phosphorylation

Disease: Polyhydramnios, Megalencephaly, And Symptomatic Epilepsy

Research Articles on STRADA

Similar Products

Product Notes

The STRADA strada (Catalog #AAA6451689) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STRADA (STE20-Related Kinase Adaptor alpha, FLJ90524, LYK5, NY-BR-96, PMSE, STRAD, Stlk) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STRADA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the STRADA strada for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "STRADA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.