Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (STAT6 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Rabbit STAT6 Polyclonal Antibody | anti-STAT6 antibody

STAT6 antibody - C-terminal region

Gene Names
STAT6; STAT6B; STAT6C; D12S1644; IL-4-STAT
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
STAT6; Polyclonal Antibody; STAT6 antibody - C-terminal region; anti-STAT6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW
Sequence Length
847
Applicable Applications for anti-STAT6 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human STAT6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(STAT6 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (STAT6 antibody - C-terminal region Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Cytoplasm of pneumocytesPrimary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-STAT6 antibody
This is a rabbit polyclonal antibody against STAT6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: STAT6 is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins.The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
signal transducer and activator of transcription 6 isoform 1
NCBI Official Synonym Full Names
signal transducer and activator of transcription 6
NCBI Official Symbol
STAT6
NCBI Official Synonym Symbols
STAT6B; STAT6C; D12S1644; IL-4-STAT
NCBI Protein Information
signal transducer and activator of transcription 6
UniProt Protein Name
Signal transducer and activator of transcription 6
UniProt Gene Name
STAT6
UniProt Entry Name
STAT6_HUMAN

NCBI Description

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.[provided by RefSeq, May 2010]

Uniprot Description

STAT6: transcription factor of the STAT family. Plays a central role in IL4-mediated biological responses. Induces the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. May function in the differentiation of T helper 2 cells and class switch of immunoglobulins. Forms homo- or heterodimers that translocate into the nucleus where they regulate transcription.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: nucleoplasm; nuclear chromatin; cytoplasm; cytosol; lipid raft

Molecular Function: identical protein binding; signal transducer activity; protein binding; transcription factor activity; protein phosphatase binding

Biological Process: regulation of transcription from RNA polymerase II promoter; T-helper 1 cell lineage commitment; negative regulation of T-helper 2 type immune response; transcription, DNA-dependent; positive regulation of interferon type I production; innate immune response; mammary gland epithelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; signal transduction; positive regulation of isotype switching to IgE isotypes; regulation of cell proliferation

Research Articles on STAT6

Similar Products

Product Notes

The STAT6 stat6 (Catalog #AAA3203984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STAT6 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's STAT6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the STAT6 stat6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TEQDLTKLLL EGQGESGGGS LGAQPLLQPS HYGQSGISMS HMDLRANPSW. It is sometimes possible for the material contained within the vial of "STAT6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.