Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ST8SIA1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ST8SIA1 Polyclonal Antibody | anti-ST8SIA1 antibody

ST8SIA1 Antibody - middle region

Gene Names
ST8SIA1; GD3S; SIAT8; SIAT8A; SIAT8-A; ST8SiaI
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ST8SIA1; Polyclonal Antibody; ST8SIA1 Antibody - middle region; anti-ST8SIA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLP
Sequence Length
356
Applicable Applications for anti-ST8SIA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human ST8SIA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ST8SIA1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ST8SIA1Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ST8SIA1 antibody
Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.
Product Categories/Family for anti-ST8SIA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39 kDa
NCBI Official Full Name
alpha-N-acetylneuraminide alpha-2,8-sialyltransferase isoform 2
NCBI Official Synonym Full Names
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
NCBI Official Symbol
ST8SIA1
NCBI Official Synonym Symbols
GD3S; SIAT8; SIAT8A; SIAT8-A; ST8SiaI
NCBI Protein Information
alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
UniProt Protein Name
Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
UniProt Gene Name
ST8SIA1
UniProt Synonym Gene Names
SIAT8; SIAT8A; SIAT8-A; ST8SiaI
UniProt Entry Name
SIA8A_HUMAN

NCBI Description

Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2015]

Uniprot Description

ST8SIA1: Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid. Belongs to the glycosyltransferase 29 family.

Protein type: Transferase; Glycan Metabolism - glycosphingolipid biosynthesis - ganglio series; Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Glycan Metabolism - glycosphingolipid biosynthesis - globo series; Membrane protein, integral; EC 2.4.99.8

Chromosomal Location of Human Ortholog: 12p12.1-p11.2

Cellular Component: Golgi membrane; integral to membrane; integral to Golgi membrane

Molecular Function: alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity; sialyltransferase activity

Biological Process: cellular protein metabolic process; glycosphingolipid biosynthetic process; dolichol-linked oligosaccharide biosynthetic process; positive regulation of cell proliferation; carbohydrate metabolic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Research Articles on ST8SIA1

Similar Products

Product Notes

The ST8SIA1 st8sia1 (Catalog #AAA3222651) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ST8SIA1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ST8SIA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ST8SIA1 st8sia1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CCDPAHLFAM TKMNSPMGKS MWYDGEFLYS FTIDNSTYSL FPQATPFQLP. It is sometimes possible for the material contained within the vial of "ST8SIA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.