Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse EPX Polyclonal Antibody | anti-EPX antibody

EPX antibody

Gene Names
EPX; EPO; EPP; EPX-PEN
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
EPX; Polyclonal Antibody; EPX antibody; Polyclonal EPX; Anti-EPX; EPO; EPX-PEN; Eosinophil Peroxidase; EPP; anti-EPX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
EPX antibody was raised against the middle region of EPX
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EPX antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
715
Applicable Applications for anti-EPX antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
EPX belongs to the peroxidase family, XPO subfamily. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD).
Cross-Reactivity
Human,Mouse
Immunogen
EPX antibody was raised using the middle region of EPX corresponding to a region with amino acids LAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-EPX antibody
Rabbit polyclonal EPX antibody raised against the middle region of EPX
Product Categories/Family for anti-EPX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53 kDa (MW of target protein)
NCBI Official Full Name
eosinophil peroxidase preproprotein
NCBI Official Synonym Full Names
eosinophil peroxidase
NCBI Official Symbol
EPX
NCBI Official Synonym Symbols
EPO; EPP; EPX-PEN
NCBI Protein Information
eosinophil peroxidase
UniProt Protein Name
Eosinophil peroxidase
Protein Family
UniProt Gene Name
EPX
UniProt Synonym Gene Names
EPER; EPO; EPP; EPO
UniProt Entry Name
PERE_HUMAN

NCBI Description

This gene is a member of the peroxidase gene family and is expressed in eosinophils. The encoded precursor protein is processed into covalently attached heavy and light chains to form the mature enzyme, which functions as an oxidant. The enzyme is released at sites of parasitic infection or allergen stimulation to mediate lysis of protozoa or parasitic worms. The gene is found in a cluster of three peroxidase genes at chromosome 17q23. Mutations in this gene result in eosinophil peroxidase deficiency. [provided by RefSeq, Sep 2009]

Uniprot Description

EPX: Mediates tyrosine nitration of secondary granule proteins in mature resting eosinophils. Shows significant inhibitory activity towards Mycobacterium tuberculosis H37Rv by inducing bacterial fragmentation and lysis. Defects in EPX are the cause of eosinophil peroxidase deficiency (EPD). EPD is an autosomal recessive defect where anomalous eosinophils are characterized by nuclear hypersegmentation, hypogranulation, and negative peroxidase and phospholipid staining. Belongs to the peroxidase family. XPO subfamily.

Protein type: Oxidoreductase; EC 1.11.1.7

Chromosomal Location of Human Ortholog: 17q23.1

Molecular Function: peroxidase activity; metal ion binding; heme binding

Biological Process: positive regulation of interleukin-4 production; negative regulation of interleukin-10 production; hydrogen peroxide catabolic process; negative regulation of interleukin-5 production; response to oxidative stress; defense response to nematode

Disease: Eosinophil Peroxidase Deficiency

Research Articles on EPX

Similar Products

Product Notes

The EPX epx (Catalog #AAA5300507) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPX antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EPX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the EPX epx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.